Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arf-GAP with dual PH domain-containing protein 1

Gene

ADAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GTPase-activating protein for the ADP ribosylation factor family (Probable). Binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4).1 PublicationCurated1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri21 – 44C4-typePROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

  • cell surface receptor signaling pathway Source: ProtInc
  • regulation of GTPase activity Source: UniProtKB

Keywordsi

Molecular functionGTPase activation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SIGNORiO75689

Names & Taxonomyi

Protein namesi
Recommended name:
Arf-GAP with dual PH domain-containing protein 1
Alternative name(s):
Centaurin-alpha-1
Short name:
Cnt-a1
Putative MAPK-activating protein PM25
Gene namesi
Name:ADAP1
Synonyms:CENTA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000105963.13
HGNCiHGNC:16486 ADAP1
MIMi608114 gene
neXtProtiNX_O75689

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi21C → A: Loss of GTPase-activating activity. 1 Publication1
Mutagenesisi24C → A: Loss of GTPase-activating activity. 1 Publication1
Mutagenesisi149R → C: 40-45% reduction in PtdInsP2 3-kinase dependent membrane localization. Almost complete loss of PtdInsP2 3-kinase dependent membrane localization; when associated with C-273. 2 Publications1
Mutagenesisi273R → C: 70% reduction in PtdInsP2 3-kinase dependent membrane localization. Almost complete loss of PtdInsP2 3-kinase dependent membrane localization; when associated with C-149. 2 Publications1

Organism-specific databases

DisGeNETi11033
OpenTargetsiENSG00000105963
PharmGKBiPA26404

Polymorphism and mutation databases

BioMutaiADAP1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000742051 – 374Arf-GAP with dual PH domain-containing protein 1Add BLAST374

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei87Phosphoserine; by PKC1 Publication1
Modified residuei272N6-acetyllysineCombined sources1
Modified residuei276Phosphothreonine; by PKC1 Publication1

Post-translational modificationi

Phosphorylated by PRKCA, PRKCI, PRKCZ and PRKD1 in vitro.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO75689
MaxQBiO75689
PaxDbiO75689
PeptideAtlasiO75689
PRIDEiO75689
ProteomicsDBi50162

PTM databases

iPTMnetiO75689
PhosphoSitePlusiO75689

Expressioni

Tissue specificityi

Expressed at highest levels in brain and at lower levels in peripheral blood leukocytes.1 Publication

Gene expression databases

BgeeiENSG00000105963 Expressed in 92 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_ADAP1
ExpressionAtlasiO75689 baseline and differential
GenevisibleiO75689 HS

Organism-specific databases

HPAiHPA007033
HPA012049

Interactioni

Subunit structurei

Interacts with PRKCA, PRKCI and PRKCZ. Interacts with the N-terminal region of PRKD1.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi116222, 18 interactors
DIPiDIP-41731N
IntActiO75689, 11 interactors
MINTiO75689
STRINGi9606.ENSP00000265846

Structurei

Secondary structure

1374
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO75689
SMRiO75689
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75689

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini7 – 126Arf-GAPPROSITE-ProRule annotationAdd BLAST120
Domaini129 – 230PH 1PROSITE-ProRule annotationAdd BLAST102
Domaini252 – 356PH 2PROSITE-ProRule annotationAdd BLAST105

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri21 – 44C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0703 Eukaryota
COG5347 LUCA
GeneTreeiENSGT00900000140892
HOGENOMiHOG000006719
HOVERGENiHBG050888
InParanoidiO75689
OMAiYEERVPP
OrthoDBiEOG091G0789
PhylomeDBiO75689
TreeFamiTF324540

Family and domain databases

CDDicd13252 PH1_ADAP, 1 hit
cd01251 PH2_ADAP, 1 hit
Gene3Di2.30.29.30, 2 hits
3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
IPR011993 PH-like_dom_sf
IPR037849 PH1_ADAP
IPR037851 PH2_ADAP
IPR001849 PH_domain
PfamiView protein in Pfam
PF01412 ArfGap, 1 hit
PF00169 PH, 2 hits
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00105 ArfGap, 1 hit
SM00233 PH, 2 hits
SUPFAMiSSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50115 ARFGAP, 1 hit
PS50003 PH_DOMAIN, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75689-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKERRRAVL ELLQRPGNAR CADCGAPDPD WASYTLGVFI CLSCSGIHRN
60 70 80 90 100
IPQVSKVKSV RLDAWEEAQV EFMASHGNDA ARARFESKVP SFYYRPTPSD
110 120 130 140 150
CQLLREQWIR AKYERQEFIY PEKQEPYSAG YREGFLWKRG RDNGQFLSRK
160 170 180 190 200
FVLTEREGAL KYFNRNDAKE PKAVMKIEHL NATFQPAKIG HPHGLQVTYL
210 220 230 240 250
KDNSTRNIFI YHEDGKEIVD WFNALRAARF HYLQVAFPGA GDADLVPKLS
260 270 280 290 300
RNYLKEGYME KTGPKQTEGF RKRWFTMDDR RLMYFKDPLD AFARGEVFIG
310 320 330 340 350
SKESGYTVLH GFPPSTQGHH WPHGITIVTP DRKFLFACET ESDQREWVAA
360 370
FQKAVDRPML PQEYAVEAHF KHKP
Length:374
Mass (Da):43,395
Last modified:November 25, 2008 - v2
Checksum:i38547281FB09D9B9
GO
Isoform 2 (identifier: O75689-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MAKERRRAVLELLQRPGNARCADCGAP → MFQFVFSRVYCINPARRKWKEFEKMLGCAEEGHASLGR

Show »
Length:385
Mass (Da):44,936
Checksum:i67ACBB2A85819D46
GO
Isoform 3 (identifier: O75689-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Show »
Length:302
Mass (Da):35,353
Checksum:i8197A42910488E1E
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y7Q1H0Y7Q1_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
357Annotation score:
H7C324H7C324_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
245Annotation score:
A0A087WTN6A0A087WTN6_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
279Annotation score:
H7BZT6H7BZT6_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
192Annotation score:
H7C4B3H7C4B3_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
187Annotation score:
H7C264H7C264_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
207Annotation score:
C9JN36C9JN36_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
162Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti215G → R in BAG52556 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_047470241G → S4 PublicationsCorresponds to variant dbSNP:rs10256887Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0547931 – 72Missing in isoform 3. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_0547941 – 27MAKER…DCGAP → MFQFVFSRVYCINPARRKWK EFEKMLGCAEEGHASLGR in isoform 2. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006422 mRNA Translation: CAA07024.1
AF082324 mRNA Translation: AAD11414.1
AB097049 mRNA Translation: BAC77402.1
AK300999 mRNA Translation: BAG62618.1
AC073957 Genomic DNA No translation available.
AK092471 mRNA Translation: BAG52556.1
CH236965 Genomic DNA Translation: EAL23709.1
CH471144 Genomic DNA Translation: EAW87183.1
CH471144 Genomic DNA Translation: EAW87184.1
BC033747 mRNA Translation: AAH33747.1
CCDSiCCDS5318.1 [O75689-1]
CCDS64576.1 [O75689-3]
CCDS64577.1 [O75689-2]
PIRiJC7091
RefSeqiNP_001271237.1, NM_001284308.1
NP_001271238.1, NM_001284309.1
NP_001271239.1, NM_001284310.1
NP_001271240.1, NM_001284311.1
NP_006860.1, NM_006869.3
UniGeneiHs.602573

Genome annotation databases

EnsembliENST00000265846; ENSP00000265846; ENSG00000105963 [O75689-1]
ENST00000449296; ENSP00000407267; ENSG00000105963 [O75689-3]
ENST00000539900; ENSP00000442682; ENSG00000105963 [O75689-2]
ENST00000611167; ENSP00000481154; ENSG00000105963 [O75689-3]
GeneIDi11033
KEGGihsa:11033
UCSCiuc003sjn.5 human [O75689-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006422 mRNA Translation: CAA07024.1
AF082324 mRNA Translation: AAD11414.1
AB097049 mRNA Translation: BAC77402.1
AK300999 mRNA Translation: BAG62618.1
AC073957 Genomic DNA No translation available.
AK092471 mRNA Translation: BAG52556.1
CH236965 Genomic DNA Translation: EAL23709.1
CH471144 Genomic DNA Translation: EAW87183.1
CH471144 Genomic DNA Translation: EAW87184.1
BC033747 mRNA Translation: AAH33747.1
CCDSiCCDS5318.1 [O75689-1]
CCDS64576.1 [O75689-3]
CCDS64577.1 [O75689-2]
PIRiJC7091
RefSeqiNP_001271237.1, NM_001284308.1
NP_001271238.1, NM_001284309.1
NP_001271239.1, NM_001284310.1
NP_001271240.1, NM_001284311.1
NP_006860.1, NM_006869.3
UniGeneiHs.602573

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FEHX-ray1.90A3-370[»]
3FM8X-ray2.30C/D1-374[»]
3LJUX-ray1.70X3-370[»]
3MDBX-ray2.95C/D1-374[»]
ProteinModelPortaliO75689
SMRiO75689
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116222, 18 interactors
DIPiDIP-41731N
IntActiO75689, 11 interactors
MINTiO75689
STRINGi9606.ENSP00000265846

PTM databases

iPTMnetiO75689
PhosphoSitePlusiO75689

Polymorphism and mutation databases

BioMutaiADAP1

Proteomic databases

EPDiO75689
MaxQBiO75689
PaxDbiO75689
PeptideAtlasiO75689
PRIDEiO75689
ProteomicsDBi50162

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265846; ENSP00000265846; ENSG00000105963 [O75689-1]
ENST00000449296; ENSP00000407267; ENSG00000105963 [O75689-3]
ENST00000539900; ENSP00000442682; ENSG00000105963 [O75689-2]
ENST00000611167; ENSP00000481154; ENSG00000105963 [O75689-3]
GeneIDi11033
KEGGihsa:11033
UCSCiuc003sjn.5 human [O75689-1]

Organism-specific databases

CTDi11033
DisGeNETi11033
EuPathDBiHostDB:ENSG00000105963.13
GeneCardsiADAP1
HGNCiHGNC:16486 ADAP1
HPAiHPA007033
HPA012049
MIMi608114 gene
neXtProtiNX_O75689
OpenTargetsiENSG00000105963
PharmGKBiPA26404
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0703 Eukaryota
COG5347 LUCA
GeneTreeiENSGT00900000140892
HOGENOMiHOG000006719
HOVERGENiHBG050888
InParanoidiO75689
OMAiYEERVPP
OrthoDBiEOG091G0789
PhylomeDBiO75689
TreeFamiTF324540

Enzyme and pathway databases

SIGNORiO75689

Miscellaneous databases

ChiTaRSiADAP1 human
EvolutionaryTraceiO75689
GeneWikiiCentaurin,_alpha_1
GenomeRNAii11033
PROiPR:O75689
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105963 Expressed in 92 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_ADAP1
ExpressionAtlasiO75689 baseline and differential
GenevisibleiO75689 HS

Family and domain databases

CDDicd13252 PH1_ADAP, 1 hit
cd01251 PH2_ADAP, 1 hit
Gene3Di2.30.29.30, 2 hits
3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
IPR011993 PH-like_dom_sf
IPR037849 PH1_ADAP
IPR037851 PH2_ADAP
IPR001849 PH_domain
PfamiView protein in Pfam
PF01412 ArfGap, 1 hit
PF00169 PH, 2 hits
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00105 ArfGap, 1 hit
SM00233 PH, 2 hits
SUPFAMiSSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50115 ARFGAP, 1 hit
PS50003 PH_DOMAIN, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiADAP1_HUMAN
AccessioniPrimary (citable) accession number: O75689
Secondary accession number(s): A4D2Q2
, B3KRZ4, B4DVA6, F6XZ68, H7C2Q4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: November 25, 2008
Last modified: November 7, 2018
This is version 157 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again