Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O75689 (ADAP1_HUMAN)

Entry version 173 (07 Apr 2021)
Sequence version 2 (25 Nov 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Arf-GAP with dual PH domain-containing protein 1

Gene

ADAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase-activating protein for the ADP ribosylation factor family (Probable). Binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4).1 PublicationCurated1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri21 – 44C4-typePROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

  • cell surface receptor signaling pathway Source: ProtInc
  • regulation of GTPase activity Source: UniProtKB
Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O75689

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1251985, Nuclear signaling by ERBB4

SIGNOR Signaling Network Open Resource

More...SIGNORi		O75689

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Arf-GAP with dual PH domain-containing protein 1
Alternative name(s):
Centaurin-alpha-1
Short name:
Cnt-a1
Putative MAPK-activating protein PM25
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAP1
Synonyms:CENTA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:16486, ADAP1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608114, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75689

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000105963.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi21C → A: Loss of GTPase-activating activity. 1 Publication1
Mutagenesisi24C → A: Loss of GTPase-activating activity. 1 Publication1
Mutagenesisi149R → C: 40-45% reduction in PtdInsP2 3-kinase dependent membrane localization. Almost complete loss of PtdInsP2 3-kinase dependent membrane localization; when associated with C-273. 2 Publications1
Mutagenesisi273R → C: 70% reduction in PtdInsP2 3-kinase dependent membrane localization. Almost complete loss of PtdInsP2 3-kinase dependent membrane localization; when associated with C-149. 2 Publications1

Organism-specific databases

DisGeNET

More...DisGeNETi		11033

Open Targets

More...OpenTargetsi		ENSG00000105963

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26404

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75689, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADAP1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000742051 – 374Arf-GAP with dual PH domain-containing protein 1Add BLAST374

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei87Phosphoserine; by PKC1 Publication1
Modified residuei272N6-acetyllysineCombined sources1
Modified residuei276Phosphothreonine; by PKC1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by PRKCA, PRKCI, PRKCZ and PRKD1 in vitro.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O75689

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O75689

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75689

MaxQB - The MaxQuant DataBase

More...MaxQBi		O75689

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75689

PeptideAtlas

More...PeptideAtlasi		O75689

PRoteomics IDEntifications database

More...PRIDEi		O75689

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		28173
45067
50162 [O75689-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75689

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75689

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at highest levels in brain and at lower levels in peripheral blood leukocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000105963, Expressed in C1 segment of cervical spinal cord and 114 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75689, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75689, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000105963, Tissue enhanced (brain, intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PRKCA, PRKCI and PRKCZ.

Interacts with the N-terminal region of PRKD1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116222, 20 interactors

Database of interacting proteins

More...DIPi		DIP-41731N

Protein interaction database and analysis system

More...IntActi		O75689, 11 interactors

Molecular INTeraction database

More...MINTi		O75689

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000442682

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75689, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1374
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O75689

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O75689

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini7 – 126Arf-GAPPROSITE-ProRule annotationAdd BLAST120
Domaini129 – 230PH 1PROSITE-ProRule annotationAdd BLAST102
Domaini252 – 356PH 2PROSITE-ProRule annotationAdd BLAST105

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri21 – 44C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0703, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155698

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_061583_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75689

Identification of Orthologs from Complete Genome Data

More...OMAi		YEERVPP

Database of Orthologous Groups

More...OrthoDBi		1274375at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75689

TreeFam database of animal gene trees

More...TreeFami		TF324540

Family and domain databases

Conserved Domains Database

More...CDDi		cd13252, PH1_ADAP, 1 hit
cd01251, PH2_ADAP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.29.30, 2 hits
3.30.40.160, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR037278, ARFGAP/RecO
IPR001164, ArfGAP_dom
IPR038508, ArfGAP_dom_sf
IPR011993, PH-like_dom_sf
IPR037849, PH1_ADAP
IPR037851, PH2_ADAP
IPR001849, PH_domain

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01412, ArfGap, 1 hit
PF00169, PH, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00405, REVINTRACTNG

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00105, ArfGap, 1 hit
SM00233, PH, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57863, SSF57863, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50115, ARFGAP, 1 hit
PS50003, PH_DOMAIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75689-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKERRRAVL ELLQRPGNAR CADCGAPDPD WASYTLGVFI CLSCSGIHRN 
        60         70         80         90        100
IPQVSKVKSV RLDAWEEAQV EFMASHGNDA ARARFESKVP SFYYRPTPSD 
       110        120        130        140        150
CQLLREQWIR AKYERQEFIY PEKQEPYSAG YREGFLWKRG RDNGQFLSRK 
       160        170        180        190        200
FVLTEREGAL KYFNRNDAKE PKAVMKIEHL NATFQPAKIG HPHGLQVTYL 
       210        220        230        240        250
KDNSTRNIFI YHEDGKEIVD WFNALRAARF HYLQVAFPGA GDADLVPKLS 
       260        270        280        290        300
RNYLKEGYME KTGPKQTEGF RKRWFTMDDR RLMYFKDPLD AFARGEVFIG 
       310        320        330        340        350
SKESGYTVLH GFPPSTQGHH WPHGITIVTP DRKFLFACET ESDQREWVAA 
       360        370 
FQKAVDRPML PQEYAVEAHF KHKP
Length:374
Mass (Da):43,395
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i38547281FB09D9B9
GO
Isoform 2 (identifier: O75689-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MAKERRRAVLELLQRPGNARCADCGAP → MFQFVFSRVYCINPARRKWKEFEKMLGCAEEGHASLGR

Show »
Length:385
Mass (Da):44,936
Checksum:i67ACBB2A85819D46
GO
Isoform 3 (identifier: O75689-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Show »
Length:302
Mass (Da):35,353
Checksum:i8197A42910488E1E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y7Q1H0Y7Q1_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
357Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C324H7C324_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
245Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WTN6A0A087WTN6_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
279Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZT6H7BZT6_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C264H7C264_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4B3H7C4B3_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISA7A0A3B3ISA7_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
373Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JN36C9JN36_HUMAN
Arf-GAP with dual PH domain-contain...
ADAP1
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti215G → R in BAG52556 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047470241G → S4 PublicationsCorresponds to variant dbSNP:rs10256887Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0547931 – 72Missing in isoform 3. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_0547941 – 27MAKER…DCGAP → MFQFVFSRVYCINPARRKWK EFEKMLGCAEEGHASLGR in isoform 2. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ006422 mRNA Translation: CAA07024.1
AF082324 mRNA Translation: AAD11414.1
AB097049 mRNA Translation: BAC77402.1
AK300999 mRNA Translation: BAG62618.1
AC073957 Genomic DNA No translation available.
AK092471 mRNA Translation: BAG52556.1
CH236965 Genomic DNA Translation: EAL23709.1
CH471144 Genomic DNA Translation: EAW87183.1
CH471144 Genomic DNA Translation: EAW87184.1
BC033747 mRNA Translation: AAH33747.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5318.1 [O75689-1]
CCDS64576.1 [O75689-3]
CCDS64577.1 [O75689-2]

Protein sequence database of the Protein Information Resource

More...PIRi		JC7091

NCBI Reference Sequences

More...RefSeqi		NP_001271237.1, NM_001284308.1
NP_001271238.1, NM_001284309.1 [O75689-3]
NP_001271239.1, NM_001284310.1
NP_001271240.1, NM_001284311.1
NP_006860.1, NM_006869.3 [O75689-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000265846; ENSP00000265846; ENSG00000105963 [O75689-1]
ENST00000449296; ENSP00000407267; ENSG00000105963 [O75689-3]
ENST00000539900; ENSP00000442682; ENSG00000105963 [O75689-2]
ENST00000611167; ENSP00000481154; ENSG00000105963 [O75689-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11033

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:11033

UCSC genome browser

More...UCSCi		uc003sjn.5, human [O75689-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006422 mRNA Translation: CAA07024.1
AF082324 mRNA Translation: AAD11414.1
AB097049 mRNA Translation: BAC77402.1
AK300999 mRNA Translation: BAG62618.1
AC073957 Genomic DNA No translation available.
AK092471 mRNA Translation: BAG52556.1
CH236965 Genomic DNA Translation: EAL23709.1
CH471144 Genomic DNA Translation: EAW87183.1
CH471144 Genomic DNA Translation: EAW87184.1
BC033747 mRNA Translation: AAH33747.1
CCDSiCCDS5318.1 [O75689-1]
CCDS64576.1 [O75689-3]
CCDS64577.1 [O75689-2]
PIRiJC7091
RefSeqiNP_001271237.1, NM_001284308.1
NP_001271238.1, NM_001284309.1 [O75689-3]
NP_001271239.1, NM_001284310.1
NP_001271240.1, NM_001284311.1
NP_006860.1, NM_006869.3 [O75689-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FEHX-ray1.90A3-370[»]
3FM8X-ray2.30C/D1-374[»]
3LJUX-ray1.70X3-370[»]
3MDBX-ray2.95C/D1-374[»]
SMRiO75689
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116222, 20 interactors
DIPiDIP-41731N
IntActiO75689, 11 interactors
MINTiO75689
STRINGi9606.ENSP00000442682

PTM databases

iPTMnetiO75689
PhosphoSitePlusiO75689

Genetic variation databases

BioMutaiADAP1

Proteomic databases

EPDiO75689
jPOSTiO75689
MassIVEiO75689
MaxQBiO75689
PaxDbiO75689
PeptideAtlasiO75689
PRIDEiO75689
ProteomicsDBi28173
45067
50162 [O75689-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1977, 221 antibodies

Genome annotation databases

EnsembliENST00000265846; ENSP00000265846; ENSG00000105963 [O75689-1]
ENST00000449296; ENSP00000407267; ENSG00000105963 [O75689-3]
ENST00000539900; ENSP00000442682; ENSG00000105963 [O75689-2]
ENST00000611167; ENSP00000481154; ENSG00000105963 [O75689-3]
GeneIDi11033
KEGGihsa:11033
UCSCiuc003sjn.5, human [O75689-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		11033
DisGeNETi11033

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADAP1
HGNCiHGNC:16486, ADAP1
HPAiENSG00000105963, Tissue enhanced (brain, intestine)
MIMi608114, gene
neXtProtiNX_O75689
OpenTargetsiENSG00000105963
PharmGKBiPA26404
VEuPathDBiHostDB:ENSG00000105963.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0703, Eukaryota
GeneTreeiENSGT00940000155698
HOGENOMiCLU_061583_0_0_1
InParanoidiO75689
OMAiYEERVPP
OrthoDBi1274375at2759
PhylomeDBiO75689
TreeFamiTF324540

Enzyme and pathway databases

PathwayCommonsiO75689
ReactomeiR-HSA-1251985, Nuclear signaling by ERBB4
SIGNORiO75689

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		11033, 21 hits in 988 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ADAP1, human
EvolutionaryTraceiO75689

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Centaurin,_alpha_1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		11033
PharosiO75689, Tbio

Protein Ontology

More...PROi		PR:O75689
RNActiO75689, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000105963, Expressed in C1 segment of cervical spinal cord and 114 other tissues
ExpressionAtlasiO75689, baseline and differential
GenevisibleiO75689, HS

Family and domain databases

CDDicd13252, PH1_ADAP, 1 hit
cd01251, PH2_ADAP, 1 hit
Gene3Di2.30.29.30, 2 hits
3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR037278, ARFGAP/RecO
IPR001164, ArfGAP_dom
IPR038508, ArfGAP_dom_sf
IPR011993, PH-like_dom_sf
IPR037849, PH1_ADAP
IPR037851, PH2_ADAP
IPR001849, PH_domain
PfamiView protein in Pfam
PF01412, ArfGap, 1 hit
PF00169, PH, 2 hits
PRINTSiPR00405, REVINTRACTNG
SMARTiView protein in SMART
SM00105, ArfGap, 1 hit
SM00233, PH, 2 hits
SUPFAMiSSF57863, SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50115, ARFGAP, 1 hit
PS50003, PH_DOMAIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADAP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75689
Secondary accession number(s): A4D2Q2
, B3KRZ4, B4DVA6, F6XZ68, H7C2Q4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: November 25, 2008
Last modified: April 7, 2021
This is version 173 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again