Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 161 (08 May 2019)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Death effector domain-containing protein

Gene

DEDD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

A scaffold protein that directs CASP3 to certain substrates and facilitates their ordered degradation during apoptosis. May also play a role in mediating CASP3 cleavage of KRT18. Regulates degradation of intermediate filaments during apoptosis. May play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3. Inhibits DNA transcription in vitro (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processApoptosis, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Death effector domain-containing protein
Alternative name(s):
DEDPro1
Death effector domain-containing testicular molecule
FLDED-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DEDD
Synonyms:DEDPRO1, DEFT
ORF Names:KE05
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2755 DEDD

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606841 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75618

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9191

Open Targets

More...
OpenTargetsi
ENSG00000158796

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27236

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DEDD

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001912741 – 318Death effector domain-containing proteinAdd BLAST318

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Exists predominantly in a mono- or diubiquitinated form.

Keywords - PTMi

Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75618

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75618

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75618

PeptideAtlas

More...
PeptideAtlasi
O75618

PRoteomics IDEntifications database

More...
PRIDEi
O75618

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50122
50123 [O75618-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75618

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75618

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000158796 Expressed in 236 organ(s), highest expression level in vagina

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75618 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75618 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA030681
HPA073628

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CASP8, CASP10, KRT8, KRT18, CASP3 and FADD. Homodimerizes and heterodimerizes with DEDD2.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114627, 24 interactors

Database of interacting proteins

More...
DIPi
DIP-41944N

Protein interaction database and analysis system

More...
IntActi
O75618, 17 interactors

Molecular INTeraction database

More...
MINTi
O75618

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000356985

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 103DEDPROSITE-ProRule annotationAdd BLAST79

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFFJ Eukaryota
ENOG410Z8U6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008714

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000049120

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75618

Database of Orthologous Groups

More...
OrthoDBi
653785at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75618

TreeFam database of animal gene trees

More...
TreeFami
TF331807

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR038856 DEDD/DEDD2

The PANTHER Classification System

More...
PANTHERi
PTHR15205 PTHR15205, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01335 DED, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00031 DED, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47986 SSF47986, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50168 DED, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75618-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGLKRRASQ VWPEEHGEQE HGLYSLHRMF DIVGTHLTHR DVRVLSFLFV
60 70 80 90 100
DVIDDHERGL IRNGRDFLLA LERQGRCDES NFRQVLQLLR IITRHDLLPY
110 120 130 140 150
VTLKRRRAVC PDLVDKYLEE TSIRYVTPRA LSDPEPRPPQ PSKTVPPHYP
160 170 180 190 200
VVCCPTSGPQ MCSKRPARGR ATLGSQRKRR KSVTPDPKEK QTCDIRLRVR
210 220 230 240 250
AEYCQHETAL QGNVFSNKQD PLERQFERFN QANTILKSRD LGSIICDIKF
260 270 280 290 300
SELTYLDAFW RDYINGSLLE ALKGVFITDS LKQAVGHEAI KLLVNVDEED
310
YELGRQKLLR NLMLQALP
Length:318
Mass (Da):36,794
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFF9D5FF9B61F6BB6
GO
Isoform 2 (identifier: O75618-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-194: D → GEEIQGFQRWSRLEGEYKELLGHWAVYAIQY

Note: No experimental confirmation available.
Show »
Length:348
Mass (Da):40,418
Checksum:i7E40585470706387
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AQP5B1AQP5_HUMAN
Death effector domain containing, i...
DEDD hCG_20845
348Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GY27V9GY27_HUMAN
Death effector domain-containing pr...
DEDD
287Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003846194D → GEEIQGFQRWSRLEGEYKEL LGHWAVYAIQY in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF083236 mRNA Translation: AAC33105.1
AF100341 mRNA Translation: AAD16414.1
AF043733 mRNA Translation: AAC80280.1
AJ010973 mRNA Translation: CAA09445.1
AF064605 mRNA Translation: AAC17110.3
CR536556 mRNA Translation: CAG38793.1
AL591806 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52648.1
CH471121 Genomic DNA Translation: EAW52650.1
CH471121 Genomic DNA Translation: EAW52651.1
CH471121 Genomic DNA Translation: EAW52652.1
CH471121 Genomic DNA Translation: EAW52653.1
BC016724 mRNA Translation: AAH16724.1
BC013910 mRNA Translation: AAH13910.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1219.1 [O75618-1]
CCDS81391.1 [O75618-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001034800.1, NM_001039711.1 [O75618-1]
NP_001034801.1, NM_001039712.1 [O75618-1]
NP_127491.1, NM_032998.2 [O75618-1]
XP_016858291.1, XM_017002802.1 [O75618-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000368006; ENSP00000356985; ENSG00000158796 [O75618-1]
ENST00000458050; ENSP00000414821; ENSG00000158796 [O75618-1]
ENST00000490843; ENSP00000476946; ENSG00000158796 [O75618-1]
ENST00000545495; ENSP00000445835; ENSG00000158796 [O75618-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9191

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9191

UCSC genome browser

More...
UCSCi
uc001fxz.5 human [O75618-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083236 mRNA Translation: AAC33105.1
AF100341 mRNA Translation: AAD16414.1
AF043733 mRNA Translation: AAC80280.1
AJ010973 mRNA Translation: CAA09445.1
AF064605 mRNA Translation: AAC17110.3
CR536556 mRNA Translation: CAG38793.1
AL591806 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52648.1
CH471121 Genomic DNA Translation: EAW52650.1
CH471121 Genomic DNA Translation: EAW52651.1
CH471121 Genomic DNA Translation: EAW52652.1
CH471121 Genomic DNA Translation: EAW52653.1
BC016724 mRNA Translation: AAH16724.1
BC013910 mRNA Translation: AAH13910.1
CCDSiCCDS1219.1 [O75618-1]
CCDS81391.1 [O75618-2]
RefSeqiNP_001034800.1, NM_001039711.1 [O75618-1]
NP_001034801.1, NM_001039712.1 [O75618-1]
NP_127491.1, NM_032998.2 [O75618-1]
XP_016858291.1, XM_017002802.1 [O75618-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi114627, 24 interactors
DIPiDIP-41944N
IntActiO75618, 17 interactors
MINTiO75618
STRINGi9606.ENSP00000356985

PTM databases

iPTMnetiO75618
PhosphoSitePlusiO75618

Polymorphism and mutation databases

BioMutaiDEDD

Proteomic databases

EPDiO75618
MaxQBiO75618
PaxDbiO75618
PeptideAtlasiO75618
PRIDEiO75618
ProteomicsDBi50122
50123 [O75618-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9191
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368006; ENSP00000356985; ENSG00000158796 [O75618-1]
ENST00000458050; ENSP00000414821; ENSG00000158796 [O75618-1]
ENST00000490843; ENSP00000476946; ENSG00000158796 [O75618-1]
ENST00000545495; ENSP00000445835; ENSG00000158796 [O75618-1]
GeneIDi9191
KEGGihsa:9191
UCSCiuc001fxz.5 human [O75618-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9191
DisGeNETi9191

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DEDD
HGNCiHGNC:2755 DEDD
HPAiHPA030681
HPA073628
MIMi606841 gene
neXtProtiNX_O75618
OpenTargetsiENSG00000158796
PharmGKBiPA27236

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFFJ Eukaryota
ENOG410Z8U6 LUCA
GeneTreeiENSGT00390000008714
HOGENOMiHOG000049120
InParanoidiO75618
OrthoDBi653785at2759
PhylomeDBiO75618
TreeFamiTF331807

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DEDD human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DEDD

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9191

Protein Ontology

More...
PROi
PR:O75618

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000158796 Expressed in 236 organ(s), highest expression level in vagina
ExpressionAtlasiO75618 baseline and differential
GenevisibleiO75618 HS

Family and domain databases

InterProiView protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR038856 DEDD/DEDD2
PANTHERiPTHR15205 PTHR15205, 1 hit
PfamiView protein in Pfam
PF01335 DED, 1 hit
SMARTiView protein in SMART
SM00031 DED, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50168 DED, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDEDD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75618
Secondary accession number(s): D3DVF5, O60737
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2002
Last sequence update: November 1, 1998
Last modified: May 8, 2019
This is version 161 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again