Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Death effector domain-containing protein

Gene

DEDD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

A scaffold protein that directs CASP3 to certain substrates and facilitates their ordered degradation during apoptosis. May also play a role in mediating CASP3 cleavage of KRT18. Regulates degradation of intermediate filaments during apoptosis. May play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3. Inhibits DNA transcription in vitro (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processApoptosis, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Death effector domain-containing protein
Alternative name(s):
DEDPro1
Death effector domain-containing testicular molecule
FLDED-1
Gene namesi
Name:DEDD
Synonyms:DEDPRO1, DEFT
ORF Names:KE05
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000158796.16
HGNCiHGNC:2755 DEDD
MIMi606841 gene
neXtProtiNX_O75618

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi9191
OpenTargetsiENSG00000158796
PharmGKBiPA27236

Polymorphism and mutation databases

BioMutaiDEDD

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001912741 – 318Death effector domain-containing proteinAdd BLAST318

Post-translational modificationi

Exists predominantly in a mono- or diubiquitinated form.

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiO75618
MaxQBiO75618
PaxDbiO75618
PeptideAtlasiO75618
PRIDEiO75618
ProteomicsDBi50122
50123 [O75618-2]

PTM databases

iPTMnetiO75618
PhosphoSitePlusiO75618

Expressioni

Tissue specificityi

Widely expressed with highest levels in testis.1 Publication

Gene expression databases

BgeeiENSG00000158796 Expressed in 236 organ(s), highest expression level in vagina
CleanExiHS_DEDD
ExpressionAtlasiO75618 baseline and differential
GenevisibleiO75618 HS

Organism-specific databases

HPAiHPA030681
HPA073628

Interactioni

Subunit structurei

Interacts with CASP8, CASP10, KRT8, KRT18, CASP3 and FADD. Homodimerizes and heterodimerizes with DEDD2.3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi114627, 24 interactors
DIPiDIP-41944N
IntActiO75618, 17 interactors
MINTiO75618
STRINGi9606.ENSP00000356985

Structurei

3D structure databases

ProteinModelPortaliO75618
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 103DEDPROSITE-ProRule annotationAdd BLAST79

Phylogenomic databases

eggNOGiENOG410IFFJ Eukaryota
ENOG410Z8U6 LUCA
GeneTreeiENSGT00390000008714
HOGENOMiHOG000049120
HOVERGENiHBG007220
InParanoidiO75618
PhylomeDBiO75618
TreeFamiTF331807

Family and domain databases

InterProiView protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR038856 DEDD/DEDD2
PANTHERiPTHR15205 PTHR15205, 1 hit
PfamiView protein in Pfam
PF01335 DED, 1 hit
SMARTiView protein in SMART
SM00031 DED, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50168 DED, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75618-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGLKRRASQ VWPEEHGEQE HGLYSLHRMF DIVGTHLTHR DVRVLSFLFV
60 70 80 90 100
DVIDDHERGL IRNGRDFLLA LERQGRCDES NFRQVLQLLR IITRHDLLPY
110 120 130 140 150
VTLKRRRAVC PDLVDKYLEE TSIRYVTPRA LSDPEPRPPQ PSKTVPPHYP
160 170 180 190 200
VVCCPTSGPQ MCSKRPARGR ATLGSQRKRR KSVTPDPKEK QTCDIRLRVR
210 220 230 240 250
AEYCQHETAL QGNVFSNKQD PLERQFERFN QANTILKSRD LGSIICDIKF
260 270 280 290 300
SELTYLDAFW RDYINGSLLE ALKGVFITDS LKQAVGHEAI KLLVNVDEED
310
YELGRQKLLR NLMLQALP
Length:318
Mass (Da):36,794
Last modified:November 1, 1998 - v1
Checksum:iFF9D5FF9B61F6BB6
GO
Isoform 2 (identifier: O75618-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-194: D → GEEIQGFQRWSRLEGEYKELLGHWAVYAIQY

Note: No experimental confirmation available.
Show »
Length:348
Mass (Da):40,418
Checksum:i7E40585470706387
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AQP5B1AQP5_HUMAN
Death effector domain containing, i...
DEDD hCG_20845
348Annotation score:
V9GY27V9GY27_HUMAN
Death effector domain-containing pr...
DEDD
287Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_003846194D → GEEIQGFQRWSRLEGEYKEL LGHWAVYAIQY in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083236 mRNA Translation: AAC33105.1
AF100341 mRNA Translation: AAD16414.1
AF043733 mRNA Translation: AAC80280.1
AJ010973 mRNA Translation: CAA09445.1
AF064605 mRNA Translation: AAC17110.3
CR536556 mRNA Translation: CAG38793.1
AL591806 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52648.1
CH471121 Genomic DNA Translation: EAW52650.1
CH471121 Genomic DNA Translation: EAW52651.1
CH471121 Genomic DNA Translation: EAW52652.1
CH471121 Genomic DNA Translation: EAW52653.1
BC016724 mRNA Translation: AAH16724.1
BC013910 mRNA Translation: AAH13910.1
CCDSiCCDS1219.1 [O75618-1]
CCDS81391.1 [O75618-2]
RefSeqiNP_001034800.1, NM_001039711.1 [O75618-1]
NP_001034801.1, NM_001039712.1 [O75618-1]
NP_127491.1, NM_032998.2 [O75618-1]
XP_016858291.1, XM_017002802.1 [O75618-1]
UniGeneiHs.744092

Genome annotation databases

EnsembliENST00000368006; ENSP00000356985; ENSG00000158796 [O75618-1]
ENST00000458050; ENSP00000414821; ENSG00000158796 [O75618-1]
ENST00000490843; ENSP00000476946; ENSG00000158796 [O75618-1]
ENST00000545495; ENSP00000445835; ENSG00000158796 [O75618-1]
GeneIDi9191
KEGGihsa:9191
UCSCiuc001fxz.5 human [O75618-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083236 mRNA Translation: AAC33105.1
AF100341 mRNA Translation: AAD16414.1
AF043733 mRNA Translation: AAC80280.1
AJ010973 mRNA Translation: CAA09445.1
AF064605 mRNA Translation: AAC17110.3
CR536556 mRNA Translation: CAG38793.1
AL591806 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52648.1
CH471121 Genomic DNA Translation: EAW52650.1
CH471121 Genomic DNA Translation: EAW52651.1
CH471121 Genomic DNA Translation: EAW52652.1
CH471121 Genomic DNA Translation: EAW52653.1
BC016724 mRNA Translation: AAH16724.1
BC013910 mRNA Translation: AAH13910.1
CCDSiCCDS1219.1 [O75618-1]
CCDS81391.1 [O75618-2]
RefSeqiNP_001034800.1, NM_001039711.1 [O75618-1]
NP_001034801.1, NM_001039712.1 [O75618-1]
NP_127491.1, NM_032998.2 [O75618-1]
XP_016858291.1, XM_017002802.1 [O75618-1]
UniGeneiHs.744092

3D structure databases

ProteinModelPortaliO75618
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114627, 24 interactors
DIPiDIP-41944N
IntActiO75618, 17 interactors
MINTiO75618
STRINGi9606.ENSP00000356985

PTM databases

iPTMnetiO75618
PhosphoSitePlusiO75618

Polymorphism and mutation databases

BioMutaiDEDD

Proteomic databases

EPDiO75618
MaxQBiO75618
PaxDbiO75618
PeptideAtlasiO75618
PRIDEiO75618
ProteomicsDBi50122
50123 [O75618-2]

Protocols and materials databases

DNASUi9191
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368006; ENSP00000356985; ENSG00000158796 [O75618-1]
ENST00000458050; ENSP00000414821; ENSG00000158796 [O75618-1]
ENST00000490843; ENSP00000476946; ENSG00000158796 [O75618-1]
ENST00000545495; ENSP00000445835; ENSG00000158796 [O75618-1]
GeneIDi9191
KEGGihsa:9191
UCSCiuc001fxz.5 human [O75618-1]

Organism-specific databases

CTDi9191
DisGeNETi9191
EuPathDBiHostDB:ENSG00000158796.16
GeneCardsiDEDD
HGNCiHGNC:2755 DEDD
HPAiHPA030681
HPA073628
MIMi606841 gene
neXtProtiNX_O75618
OpenTargetsiENSG00000158796
PharmGKBiPA27236
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFFJ Eukaryota
ENOG410Z8U6 LUCA
GeneTreeiENSGT00390000008714
HOGENOMiHOG000049120
HOVERGENiHBG007220
InParanoidiO75618
PhylomeDBiO75618
TreeFamiTF331807

Miscellaneous databases

ChiTaRSiDEDD human
GeneWikiiDEDD
GenomeRNAii9191
PROiPR:O75618
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000158796 Expressed in 236 organ(s), highest expression level in vagina
CleanExiHS_DEDD
ExpressionAtlasiO75618 baseline and differential
GenevisibleiO75618 HS

Family and domain databases

InterProiView protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR038856 DEDD/DEDD2
PANTHERiPTHR15205 PTHR15205, 1 hit
PfamiView protein in Pfam
PF01335 DED, 1 hit
SMARTiView protein in SMART
SM00031 DED, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50168 DED, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDEDD_HUMAN
AccessioniPrimary (citable) accession number: O75618
Secondary accession number(s): D3DVF5, O60737
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2002
Last sequence update: November 1, 1998
Last modified: September 12, 2018
This is version 157 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again