Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sperm-associated antigen 6

Gene

SPAG6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.By similarity1 Publication

GO - Biological processi

  • cell projection organization Source: UniProtKB-KW
  • spermatid development Source: ProtInc

Keywordsi

Biological processCilium biogenesis/degradation

Enzyme and pathway databases

SignaLinkiO75602

Names & Taxonomyi

Protein namesi
Recommended name:
Sperm-associated antigen 6
Alternative name(s):
Protein PF16 homolog
Repro-SA-1
Sperm flagellar protein
Gene namesi
Name:SPAG6
Synonyms:PF16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000077327.15
HGNCiHGNC:11215 SPAG6
MIMi605730 gene
neXtProtiNX_O75602

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi9576
OpenTargetsiENSG00000077327
PharmGKBiPA36051

Polymorphism and mutation databases

BioMutaiSPAG6

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000720951 – 509Sperm-associated antigen 6Add BLAST509

Proteomic databases

PaxDbiO75602
PeptideAtlasiO75602
PRIDEiO75602
ProteomicsDBi50107
50108 [O75602-2]
50109 [O75602-3]
50110 [O75602-4]

PTM databases

iPTMnetiO75602
PhosphoSitePlusiO75602

Expressioni

Tissue specificityi

Highly expressed in testis.1 Publication

Gene expression databases

BgeeiENSG00000077327
CleanExiHS_SPAG6
ExpressionAtlasiO75602 baseline and differential
GenevisibleiO75602 HS

Organism-specific databases

HPAiHPA038440

Interactioni

Subunit structurei

Interacts with SPAG16 and SPAG17.By similarity

Protein-protein interaction databases

BioGridi114945, 2 interactors
STRINGi9606.ENSP00000365811

Structurei

3D structure databases

ProteinModelPortaliO75602
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati31 – 70ARM 1Add BLAST40
Repeati73 – 112ARM 2Add BLAST40
Repeati115 – 154ARM 3Add BLAST40
Repeati157 – 196ARM 4Add BLAST40
Repeati199 – 238ARM 5Add BLAST40
Repeati241 – 280ARM 6Add BLAST40
Repeati325 – 365ARM 7Add BLAST41
Repeati368 – 409ARM 8Add BLAST42

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0166 Eukaryota
COG5064 LUCA
GeneTreeiENSGT00900000141099
HOVERGENiHBG055326
InParanoidiO75602
OMAiRVENYQP
OrthoDBiEOG091G07CA
PhylomeDBiO75602
TreeFamiTF328894

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
PfamiView protein in Pfam
PF00514 Arm, 4 hits
SMARTiView protein in SMART
SM00185 ARM, 7 hits
SUPFAMiSSF48371 SSF48371, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O75602-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQRQVLQVF EQYQKARTQF VQMVAELATR PQNIETLQNA GVMSLLRTLL
60 70 80 90 100
LDVVPTIQQT AALALGRLAN YNDDLAEAVV KCDILPQLVY SLAEQNRFYK
110 120 130 140 150
KAAAFVLRAV GKHSPQLAQA IVDCGALDTL VICLEDFDPG VKEAAAWALR
160 170 180 190 200
YIARHNAELS QAVVDAGAVP LLVLCIQEPE IALKRIAASA LSDIAKHSPE
210 220 230 240 250
LAQTVVDAGA VAHLAQMILN PDAKLKHQIL SALSQVSKHS VDLAEMVVEA
260 270 280 290 300
EIFPVVLTCL KDKDEYVKKN ASTLIREIAK HTPELSQLVV NAGGVAAVID
310 320 330 340 350
CIGSCKGNTR LPGIMMLGYV AAHSENLAMA VIISKGVPQL SVCLSEEPED
360 370 380 390 400
HIKAAAAWAL GQIGRHTPEH ARAVAVTNTL PVLLSLYMST ESSEDLQVKS
410 420 430 440 450
KKAIKNILQK CTYLPALEPF LYDAPPNILK HVVGQFSKVL PHDSKARRLF
460 470 480 490 500
VTSGGLKKVQ EIKAEPGSLL QEYINSINSC YPEEIVRYYS PGYSDTLLQR

VDSYQPLNN
Length:509
Mass (Da):55,476
Last modified:November 1, 1998 - v1
Checksum:i03D868E31D3883E1
GO
Isoform 2 (identifier: O75602-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-458: PHDSKARRLFVTSGGLKK → FPWIFRYTSAEGGQLSTT
     459-509: Missing.

Show »
Length:458
Mass (Da):49,660
Checksum:i45654F0A31FD4B7A
GO
Isoform 3 (identifier: O75602-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-41: G → GEPGARTPVA...SLFPSSLHTG

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:585
Mass (Da):63,490
Checksum:i2A08F5EC8547BA88
GO
Isoform 4 (identifier: O75602-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-335: Missing.

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:270
Mass (Da):30,079
Checksum:i7DFE341A6E73387D
GO
Isoform 5 (identifier: O75602-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQN → MHSLTMDLWIPNGQ

Show »
Length:484
Mass (Da):52,466
Checksum:i99D7065A5CD569A8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti60T → I in AAH30585 (PubMed:15489334).Curated1
Sequence conflicti161Q → R in CAG38583 (Ref. 3) Curated1
Sequence conflicti185R → G in AAH30585 (PubMed:15489334).Curated1
Sequence conflicti195A → V in AAH30585 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035659106V → L in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_024282216Q → R. Corresponds to variant dbSNP:rs7074847Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0453371 – 39MSQRQ…ETLQN → MHSLTMDLWIPNGQ in isoform 5. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_01344241G → GEPGARTPVAPRALSPRRLR PAALPVELLGSRSVGTGVRK SIHSFQRVFGGQAERVKLPD GCGRCALSLFPSSLHTG in isoform 3. Curated1
Alternative sequenceiVSP_01344397 – 335Missing in isoform 4. CuratedAdd BLAST239
Alternative sequenceiVSP_013444441 – 458PHDSK…GGLKK → FPWIFRYTSAEGGQLSTT in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_013445459 – 509Missing in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF079363 mRNA Translation: AAC32590.1
AL080136 mRNA Translation: CAB45730.1
CR533552 mRNA Translation: CAG38583.1
AK289903 mRNA Translation: BAF82592.1
AK302194 mRNA Translation: BAG63556.1
AL158211 Genomic DNA No translation available.
AL513128 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86146.1
BC030585 mRNA Translation: AAH30585.1
CCDSiCCDS58071.1 [O75602-5]
CCDS7139.1 [O75602-1]
CCDS7140.1 [O75602-2]
PIRiT12521
RefSeqiNP_001240783.1, NM_001253854.1 [O75602-5]
NP_001240784.1, NM_001253855.1
NP_036575.1, NM_012443.3 [O75602-1]
NP_758442.1, NM_172242.2 [O75602-2]
UniGeneiHs.655170

Genome annotation databases

EnsembliENST00000313311; ENSP00000323599; ENSG00000077327 [O75602-2]
ENST00000376624; ENSP00000365811; ENSG00000077327 [O75602-1]
ENST00000538630; ENSP00000441325; ENSG00000077327 [O75602-5]
GeneIDi9576
KEGGihsa:9576
UCSCiuc001iri.4 human [O75602-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSPAG6_HUMAN
AccessioniPrimary (citable) accession number: O75602
Secondary accession number(s): A8K1I8
, B4DXZ4, Q5VUX5, Q5VUX6, Q5VUX7, Q6FI74, Q8NHQ6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: November 1, 1998
Last modified: June 20, 2018
This is version 146 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health