Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 152 (08 May 2019)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sperm-associated antigen 6

Gene

SPAG6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O75602

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sperm-associated antigen 6
Alternative name(s):
Protein PF16 homolog
Repro-SA-1
Sperm flagellar protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPAG6
Synonyms:PF16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11215 SPAG6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605730 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75602

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9576

Open Targets

More...
OpenTargetsi
ENSG00000077327

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36051

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPAG6

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000720951 – 509Sperm-associated antigen 6Add BLAST509

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75602

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75602

PeptideAtlas

More...
PeptideAtlasi
O75602

PRoteomics IDEntifications database

More...
PRIDEi
O75602

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50107
50108 [O75602-2]
50109 [O75602-3]
50110 [O75602-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75602

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75602

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000077327 Expressed in 96 organ(s), highest expression level in bronchial epithelial cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75602 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75602 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038440

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SPAG16 and SPAG17.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114945, 2 interactors

Protein interaction database and analysis system

More...
IntActi
O75602, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000365811

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati31 – 70ARM 1Add BLAST40
Repeati73 – 112ARM 2Add BLAST40
Repeati115 – 154ARM 3Add BLAST40
Repeati157 – 196ARM 4Add BLAST40
Repeati199 – 238ARM 5Add BLAST40
Repeati241 – 280ARM 6Add BLAST40
Repeati325 – 365ARM 7Add BLAST41
Repeati368 – 409ARM 8Add BLAST42

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0166 Eukaryota
COG5064 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00900000141099

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75602

Identification of Orthologs from Complete Genome Data

More...
OMAi
RVENYQP

Database of Orthologous Groups

More...
OrthoDBi
577008at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75602

TreeFam database of animal gene trees

More...
TreeFami
TF328894

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00514 Arm, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00185 ARM, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75602-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQRQVLQVF EQYQKARTQF VQMVAELATR PQNIETLQNA GVMSLLRTLL
60 70 80 90 100
LDVVPTIQQT AALALGRLAN YNDDLAEAVV KCDILPQLVY SLAEQNRFYK
110 120 130 140 150
KAAAFVLRAV GKHSPQLAQA IVDCGALDTL VICLEDFDPG VKEAAAWALR
160 170 180 190 200
YIARHNAELS QAVVDAGAVP LLVLCIQEPE IALKRIAASA LSDIAKHSPE
210 220 230 240 250
LAQTVVDAGA VAHLAQMILN PDAKLKHQIL SALSQVSKHS VDLAEMVVEA
260 270 280 290 300
EIFPVVLTCL KDKDEYVKKN ASTLIREIAK HTPELSQLVV NAGGVAAVID
310 320 330 340 350
CIGSCKGNTR LPGIMMLGYV AAHSENLAMA VIISKGVPQL SVCLSEEPED
360 370 380 390 400
HIKAAAAWAL GQIGRHTPEH ARAVAVTNTL PVLLSLYMST ESSEDLQVKS
410 420 430 440 450
KKAIKNILQK CTYLPALEPF LYDAPPNILK HVVGQFSKVL PHDSKARRLF
460 470 480 490 500
VTSGGLKKVQ EIKAEPGSLL QEYINSINSC YPEEIVRYYS PGYSDTLLQR

VDSYQPLNN
Length:509
Mass (Da):55,476
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i03D868E31D3883E1
GO
Isoform 2 (identifier: O75602-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-458: PHDSKARRLFVTSGGLKK → FPWIFRYTSAEGGQLSTT
     459-509: Missing.

Show »
Length:458
Mass (Da):49,660
Checksum:i45654F0A31FD4B7A
GO
Isoform 3 (identifier: O75602-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-41: G → GEPGARTPVA...SLFPSSLHTG

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:585
Mass (Da):63,490
Checksum:i2A08F5EC8547BA88
GO
Isoform 4 (identifier: O75602-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-335: Missing.

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:270
Mass (Da):30,079
Checksum:i7DFE341A6E73387D
GO
Isoform 5 (identifier: O75602-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQN → MHSLTMDLWIPNGQ

Show »
Length:484
Mass (Da):52,466
Checksum:i99D7065A5CD569A8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRT8A0A0A0MRT8_HUMAN
Sperm-associated antigen 6
SPAG6
484Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSY0A0A0A0MSY0_HUMAN
Sperm-associated antigen 6
SPAG6
246Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT17A0A0A0MT17_HUMAN
Sperm-associated antigen 6
SPAG6
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti60T → I in AAH30585 (PubMed:15489334).Curated1
Sequence conflicti161Q → R in CAG38583 (Ref. 3) Curated1
Sequence conflicti185R → G in AAH30585 (PubMed:15489334).Curated1
Sequence conflicti195A → V in AAH30585 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035659106V → L in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_024282216Q → R. Corresponds to variant dbSNP:rs7074847Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0453371 – 39MSQRQ…ETLQN → MHSLTMDLWIPNGQ in isoform 5. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_01344241G → GEPGARTPVAPRALSPRRLR PAALPVELLGSRSVGTGVRK SIHSFQRVFGGQAERVKLPD GCGRCALSLFPSSLHTG in isoform 3. Curated1
Alternative sequenceiVSP_01344397 – 335Missing in isoform 4. CuratedAdd BLAST239
Alternative sequenceiVSP_013444441 – 458PHDSK…GGLKK → FPWIFRYTSAEGGQLSTT in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_013445459 – 509Missing in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF079363 mRNA Translation: AAC32590.1
AL080136 mRNA Translation: CAB45730.1
CR533552 mRNA Translation: CAG38583.1
AK289903 mRNA Translation: BAF82592.1
AK302194 mRNA Translation: BAG63556.1
AL158211 Genomic DNA No translation available.
AL513128 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86146.1
BC030585 mRNA Translation: AAH30585.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58071.1 [O75602-5]
CCDS7139.1 [O75602-1]
CCDS7140.1 [O75602-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T12521

NCBI Reference Sequences

More...
RefSeqi
NP_001240783.1, NM_001253854.1 [O75602-5]
NP_001240784.1, NM_001253855.1
NP_036575.1, NM_012443.3 [O75602-1]
NP_758442.1, NM_172242.2 [O75602-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000313311; ENSP00000323599; ENSG00000077327 [O75602-2]
ENST00000376624; ENSP00000365811; ENSG00000077327 [O75602-1]
ENST00000538630; ENSP00000441325; ENSG00000077327 [O75602-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9576

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9576

UCSC genome browser

More...
UCSCi
uc001iri.4 human [O75602-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF079363 mRNA Translation: AAC32590.1
AL080136 mRNA Translation: CAB45730.1
CR533552 mRNA Translation: CAG38583.1
AK289903 mRNA Translation: BAF82592.1
AK302194 mRNA Translation: BAG63556.1
AL158211 Genomic DNA No translation available.
AL513128 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86146.1
BC030585 mRNA Translation: AAH30585.1
CCDSiCCDS58071.1 [O75602-5]
CCDS7139.1 [O75602-1]
CCDS7140.1 [O75602-2]
PIRiT12521
RefSeqiNP_001240783.1, NM_001253854.1 [O75602-5]
NP_001240784.1, NM_001253855.1
NP_036575.1, NM_012443.3 [O75602-1]
NP_758442.1, NM_172242.2 [O75602-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi114945, 2 interactors
IntActiO75602, 1 interactor
STRINGi9606.ENSP00000365811

PTM databases

iPTMnetiO75602
PhosphoSitePlusiO75602

Polymorphism and mutation databases

BioMutaiSPAG6

Proteomic databases

jPOSTiO75602
PaxDbiO75602
PeptideAtlasiO75602
PRIDEiO75602
ProteomicsDBi50107
50108 [O75602-2]
50109 [O75602-3]
50110 [O75602-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9576
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313311; ENSP00000323599; ENSG00000077327 [O75602-2]
ENST00000376624; ENSP00000365811; ENSG00000077327 [O75602-1]
ENST00000538630; ENSP00000441325; ENSG00000077327 [O75602-5]
GeneIDi9576
KEGGihsa:9576
UCSCiuc001iri.4 human [O75602-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9576
DisGeNETi9576

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPAG6
HGNCiHGNC:11215 SPAG6
HPAiHPA038440
MIMi605730 gene
neXtProtiNX_O75602
OpenTargetsiENSG00000077327
PharmGKBiPA36051

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0166 Eukaryota
COG5064 LUCA
GeneTreeiENSGT00900000141099
InParanoidiO75602
OMAiRVENYQP
OrthoDBi577008at2759
PhylomeDBiO75602
TreeFamiTF328894

Enzyme and pathway databases

SignaLinkiO75602

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPAG6 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SPAG6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9576

Protein Ontology

More...
PROi
PR:O75602

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000077327 Expressed in 96 organ(s), highest expression level in bronchial epithelial cell
ExpressionAtlasiO75602 baseline and differential
GenevisibleiO75602 HS

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
PfamiView protein in Pfam
PF00514 Arm, 4 hits
SMARTiView protein in SMART
SM00185 ARM, 7 hits
SUPFAMiSSF48371 SSF48371, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPAG6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75602
Secondary accession number(s): A8K1I8
, B4DXZ4, Q5VUX5, Q5VUX6, Q5VUX7, Q6FI74, Q8NHQ6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: November 1, 1998
Last modified: May 8, 2019
This is version 152 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again