Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-directed RNA polymerase III subunit RPC9

Gene

CRCP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).By similarity
Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAntiviral defense, Immunity, Innate immunity, Transcription

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1834949 Cytosolic sensors of pathogen-associated DNA
R-HSA-73780 RNA Polymerase III Chain Elongation
R-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
R-HSA-76061 RNA Polymerase III Transcription Initiation From Type 1 Promoter
R-HSA-76066 RNA Polymerase III Transcription Initiation From Type 2 Promoter
R-HSA-76071 RNA Polymerase III Transcription Initiation From Type 3 Promoter

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA-directed RNA polymerase III subunit RPC9
Short name:
RNA polymerase III subunit C9
Alternative name(s):
Calcitonin gene-related peptide-receptor component protein
Short name:
CGRP-RCP
Short name:
CGRP-receptor component protein
Short name:
CGRPRCP
Short name:
HsC17
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CRCP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000241258.6

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17888 CRCP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606121 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75575

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, DNA-directed RNA polymerase, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
27297

Open Targets

More...
OpenTargetsi
ENSG00000241258

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164718123

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CRCP

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000793351 – 148DNA-directed RNA polymerase III subunit RPC9Add BLAST148

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75575

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75575

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75575

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75575

PeptideAtlas

More...
PeptideAtlasi
O75575

PRoteomics IDEntifications database

More...
PRIDEi
O75575

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50092
50093 [O75575-2]
50094 [O75575-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75575

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75575

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Most prevalent in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000241258 Expressed in 213 organ(s), highest expression level in frontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75575 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75575 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA007216

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the RNA polymerase III (Pol III) complex consisting of 17 subunits (By similarity). Interacts with POLR3H/RPC8. POLR3H/RPC8 and CRCP/RPC9 probably form a Pol III subcomplex.By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118121, 27 interactors

Protein interaction database and analysis system

More...
IntActi
O75575, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378736

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75575

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75575

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4168 Eukaryota
ENOG4111TUG LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014189

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000244081

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG023697

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75575

Identification of Orthologs from Complete Genome Data

More...
OMAi
NKHSTGQ

Database of Orthologous Groups

More...
OrthoDBi
1634280at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75575

TreeFam database of animal gene trees

More...
TreeFami
TF323294

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1250.40, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR010997 HRDC-like_sf
IPR006590 RNA_pol_Rpb4/RPC9_core
IPR005574 RPB4/RPC9
IPR038324 Rpb4/RPC9_sf
IPR038846 RPC9

The PANTHER Classification System

More...
PANTHERi
PTHR15561 PTHR15561, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03874 RNA_pol_Rpb4, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00657 RPOL4c, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47819 SSF47819, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O75575-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVKDANSAL LSNYEVFQLL TDLKEQRKES GKNKHSSGQQ NLNTITYETL
60 70 80 90 100
KYISKTPCRH QSPEIVREFL TALKSHKLTK AEKLQLLNHR PVTAVEIQLM
110 120 130 140
VEESEERLTE EQIEALLHTV TSILPAEPEA EQKKNTNSNV AMDEEDPA
Length:148
Mass (Da):16,871
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i75943BA57A63AF3D
GO
Isoform 2 (identifier: O75575-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-46: Missing.

Show »
Length:115
Mass (Da):13,054
Checksum:i60F5C22410882C26
GO
Isoform 3 (identifier: O75575-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MEVKDANSALLSN → MQRGDPGEHLGARSWHLGAVGGGGDSCEVKDANSALLSN
     14-46: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):15,613
Checksum:i0A92F564E3A59C9A
GO
Isoform 4 (identifier: O75575-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     4-80: Missing.

Note: No experimental confirmation available.
Show »
Length:71
Mass (Da):8,011
Checksum:i9CF80A5EFAA7B63A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BY40H7BY40_HUMAN
DNA-directed RNA polymerase III sub...
CRCP
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0432491 – 13MEVKD…ALLSN → MQRGDPGEHLGARSWHLGAV GGGGDSCEVKDANSALLSN in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0462734 – 80Missing in isoform 4. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_00753814 – 46Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF073792 mRNA Translation: AAC25992.1
U51134 mRNA Translation: AAD05036.1
AK290553 mRNA Translation: BAF83242.1
AK303737 mRNA Translation: BAG64710.1
AK311829 mRNA Translation: BAG34771.1
BP233211 mRNA No translation available.
BX647867 mRNA Translation: CAI46069.1
AC068533 Genomic DNA No translation available.
CH471140 Genomic DNA Translation: EAX07941.1
BC040107 mRNA Translation: AAH40107.1
BC105808 mRNA Translation: AAI05809.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47599.1 [O75575-2]
CCDS47600.1 [O75575-4]
CCDS55116.1 [O75575-3]
CCDS5532.1 [O75575-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001035737.1, NM_001040647.1 [O75575-2]
NP_001035738.1, NM_001040648.1 [O75575-4]
NP_001135886.1, NM_001142414.1 [O75575-3]
NP_055293.1, NM_014478.4 [O75575-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.300684

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000338592; ENSP00000340044; ENSG00000241258 [O75575-2]
ENST00000395326; ENSP00000378736; ENSG00000241258 [O75575-1]
ENST00000398684; ENSP00000381674; ENSG00000241258 [O75575-4]
ENST00000431089; ENSP00000388653; ENSG00000241258 [O75575-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
27297

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:27297

UCSC genome browser

More...
UCSCi
uc003tus.4 human [O75575-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073792 mRNA Translation: AAC25992.1
U51134 mRNA Translation: AAD05036.1
AK290553 mRNA Translation: BAF83242.1
AK303737 mRNA Translation: BAG64710.1
AK311829 mRNA Translation: BAG34771.1
BP233211 mRNA No translation available.
BX647867 mRNA Translation: CAI46069.1
AC068533 Genomic DNA No translation available.
CH471140 Genomic DNA Translation: EAX07941.1
BC040107 mRNA Translation: AAH40107.1
BC105808 mRNA Translation: AAI05809.1
CCDSiCCDS47599.1 [O75575-2]
CCDS47600.1 [O75575-4]
CCDS55116.1 [O75575-3]
CCDS5532.1 [O75575-1]
RefSeqiNP_001035737.1, NM_001040647.1 [O75575-2]
NP_001035738.1, NM_001040648.1 [O75575-4]
NP_001135886.1, NM_001142414.1 [O75575-3]
NP_055293.1, NM_014478.4 [O75575-1]
UniGeneiHs.300684

3D structure databases

ProteinModelPortaliO75575
SMRiO75575
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118121, 27 interactors
IntActiO75575, 10 interactors
STRINGi9606.ENSP00000378736

PTM databases

iPTMnetiO75575
PhosphoSitePlusiO75575

Polymorphism and mutation databases

BioMutaiCRCP

Proteomic databases

EPDiO75575
jPOSTiO75575
MaxQBiO75575
PaxDbiO75575
PeptideAtlasiO75575
PRIDEiO75575
ProteomicsDBi50092
50093 [O75575-2]
50094 [O75575-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
27297
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338592; ENSP00000340044; ENSG00000241258 [O75575-2]
ENST00000395326; ENSP00000378736; ENSG00000241258 [O75575-1]
ENST00000398684; ENSP00000381674; ENSG00000241258 [O75575-4]
ENST00000431089; ENSP00000388653; ENSG00000241258 [O75575-3]
GeneIDi27297
KEGGihsa:27297
UCSCiuc003tus.4 human [O75575-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27297
DisGeNETi27297
EuPathDBiHostDB:ENSG00000241258.6

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CRCP
HGNCiHGNC:17888 CRCP
HPAiHPA007216
MIMi606121 gene
neXtProtiNX_O75575
OpenTargetsiENSG00000241258
PharmGKBiPA164718123

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4168 Eukaryota
ENOG4111TUG LUCA
GeneTreeiENSGT00390000014189
HOGENOMiHOG000244081
HOVERGENiHBG023697
InParanoidiO75575
OMAiNKHSTGQ
OrthoDBi1634280at2759
PhylomeDBiO75575
TreeFamiTF323294

Enzyme and pathway databases

ReactomeiR-HSA-1834949 Cytosolic sensors of pathogen-associated DNA
R-HSA-73780 RNA Polymerase III Chain Elongation
R-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
R-HSA-76061 RNA Polymerase III Transcription Initiation From Type 1 Promoter
R-HSA-76066 RNA Polymerase III Transcription Initiation From Type 2 Promoter
R-HSA-76071 RNA Polymerase III Transcription Initiation From Type 3 Promoter

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CRCP human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RCP9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
27297

Protein Ontology

More...
PROi
PR:O75575

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000241258 Expressed in 213 organ(s), highest expression level in frontal cortex
ExpressionAtlasiO75575 baseline and differential
GenevisibleiO75575 HS

Family and domain databases

Gene3Di1.20.1250.40, 1 hit
InterProiView protein in InterPro
IPR010997 HRDC-like_sf
IPR006590 RNA_pol_Rpb4/RPC9_core
IPR005574 RPB4/RPC9
IPR038324 Rpb4/RPC9_sf
IPR038846 RPC9
PANTHERiPTHR15561 PTHR15561, 1 hit
PfamiView protein in Pfam
PF03874 RNA_pol_Rpb4, 1 hit
SMARTiView protein in SMART
SM00657 RPOL4c, 1 hit
SUPFAMiSSF47819 SSF47819, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRPC9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75575
Secondary accession number(s): A8MUZ4
, A8MW23, B2R4H4, B4E198, Q3KRA3, Q5HYF1, Q8IXL4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1998
Last modified: January 16, 2019
This is version 142 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again