Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-directed RNA polymerase III subunit RPC9

Gene

CRCP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).By similarity
Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processAntiviral defense, Immunity, Innate immunity, Transcription

Enzyme and pathway databases

ReactomeiR-HSA-1834949 Cytosolic sensors of pathogen-associated DNA
R-HSA-73780 RNA Polymerase III Chain Elongation
R-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
R-HSA-76061 RNA Polymerase III Transcription Initiation From Type 1 Promoter
R-HSA-76066 RNA Polymerase III Transcription Initiation From Type 2 Promoter
R-HSA-76071 RNA Polymerase III Transcription Initiation From Type 3 Promoter

Names & Taxonomyi

Protein namesi
Recommended name:
DNA-directed RNA polymerase III subunit RPC9
Short name:
RNA polymerase III subunit C9
Alternative name(s):
Calcitonin gene-related peptide-receptor component protein
Short name:
CGRP-RCP
Short name:
CGRP-receptor component protein
Short name:
CGRPRCP
Short name:
HsC17
Gene namesi
Name:CRCP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000241258.6
HGNCiHGNC:17888 CRCP
MIMi606121 gene
neXtProtiNX_O75575

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, DNA-directed RNA polymerase, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi27297
OpenTargetsiENSG00000241258
PharmGKBiPA164718123

Polymorphism and mutation databases

BioMutaiCRCP

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000793351 – 148DNA-directed RNA polymerase III subunit RPC9Add BLAST148

Proteomic databases

EPDiO75575
MaxQBiO75575
PaxDbiO75575
PeptideAtlasiO75575
PRIDEiO75575
ProteomicsDBi50092
50093 [O75575-2]
50094 [O75575-3]

PTM databases

iPTMnetiO75575
PhosphoSitePlusiO75575

Expressioni

Tissue specificityi

Ubiquitous. Most prevalent in testis.1 Publication

Gene expression databases

BgeeiENSG00000241258 Expressed in 213 organ(s), highest expression level in frontal cortex
ExpressionAtlasiO75575 baseline and differential
GenevisibleiO75575 HS

Organism-specific databases

HPAiHPA007216

Interactioni

Subunit structurei

Component of the RNA polymerase III (Pol III) complex consisting of 17 subunits (By similarity). Interacts with POLR3H/RPC8. POLR3H/RPC8 and CRCP/RPC9 probably form a Pol III subcomplex.By similarity2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi118121, 27 interactors
IntActiO75575, 10 interactors
STRINGi9606.ENSP00000378736

Structurei

3D structure databases

ProteinModelPortaliO75575
SMRiO75575
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG4168 Eukaryota
ENOG4111TUG LUCA
GeneTreeiENSGT00390000014189
HOGENOMiHOG000244081
HOVERGENiHBG023697
InParanoidiO75575
OMAiNKHSTGQ
OrthoDBiEOG091G0ZNH
PhylomeDBiO75575
TreeFamiTF323294

Family and domain databases

Gene3Di1.20.1250.40, 1 hit
InterProiView protein in InterPro
IPR010997 HRDC-like_sf
IPR006590 RNA_pol_Rpb4/RPC9_core
IPR005574 RPB4/RPC9
IPR038324 Rpb4/RPC9_sf
IPR038846 RPC9
PANTHERiPTHR15561 PTHR15561, 1 hit
PfamiView protein in Pfam
PF03874 RNA_pol_Rpb4, 1 hit
SMARTiView protein in SMART
SM00657 RPOL4c, 1 hit
SUPFAMiSSF47819 SSF47819, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O75575-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVKDANSAL LSNYEVFQLL TDLKEQRKES GKNKHSSGQQ NLNTITYETL
60 70 80 90 100
KYISKTPCRH QSPEIVREFL TALKSHKLTK AEKLQLLNHR PVTAVEIQLM
110 120 130 140
VEESEERLTE EQIEALLHTV TSILPAEPEA EQKKNTNSNV AMDEEDPA
Length:148
Mass (Da):16,871
Last modified:November 1, 1998 - v1
Checksum:i75943BA57A63AF3D
GO
Isoform 2 (identifier: O75575-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-46: Missing.

Show »
Length:115
Mass (Da):13,054
Checksum:i60F5C22410882C26
GO
Isoform 3 (identifier: O75575-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MEVKDANSALLSN → MQRGDPGEHLGARSWHLGAVGGGGDSCEVKDANSALLSN
     14-46: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):15,613
Checksum:i0A92F564E3A59C9A
GO
Isoform 4 (identifier: O75575-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     4-80: Missing.

Note: No experimental confirmation available.
Show »
Length:71
Mass (Da):8,011
Checksum:i9CF80A5EFAA7B63A
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BY40H7BY40_HUMAN
DNA-directed RNA polymerase III sub...
CRCP
42Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0432491 – 13MEVKD…ALLSN → MQRGDPGEHLGARSWHLGAV GGGGDSCEVKDANSALLSN in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0462734 – 80Missing in isoform 4. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_00753814 – 46Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073792 mRNA Translation: AAC25992.1
U51134 mRNA Translation: AAD05036.1
AK290553 mRNA Translation: BAF83242.1
AK303737 mRNA Translation: BAG64710.1
AK311829 mRNA Translation: BAG34771.1
BP233211 mRNA No translation available.
BX647867 mRNA Translation: CAI46069.1
AC068533 Genomic DNA No translation available.
CH471140 Genomic DNA Translation: EAX07941.1
BC040107 mRNA Translation: AAH40107.1
BC105808 mRNA Translation: AAI05809.1
CCDSiCCDS47599.1 [O75575-2]
CCDS47600.1 [O75575-4]
CCDS55116.1 [O75575-3]
CCDS5532.1 [O75575-1]
RefSeqiNP_001035737.1, NM_001040647.1 [O75575-2]
NP_001035738.1, NM_001040648.1 [O75575-4]
NP_001135886.1, NM_001142414.1 [O75575-3]
NP_055293.1, NM_014478.4 [O75575-1]
UniGeneiHs.300684

Genome annotation databases

EnsembliENST00000338592; ENSP00000340044; ENSG00000241258 [O75575-2]
ENST00000395326; ENSP00000378736; ENSG00000241258 [O75575-1]
ENST00000398684; ENSP00000381674; ENSG00000241258 [O75575-4]
ENST00000431089; ENSP00000388653; ENSG00000241258 [O75575-3]
GeneIDi27297
KEGGihsa:27297
UCSCiuc003tus.4 human [O75575-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073792 mRNA Translation: AAC25992.1
U51134 mRNA Translation: AAD05036.1
AK290553 mRNA Translation: BAF83242.1
AK303737 mRNA Translation: BAG64710.1
AK311829 mRNA Translation: BAG34771.1
BP233211 mRNA No translation available.
BX647867 mRNA Translation: CAI46069.1
AC068533 Genomic DNA No translation available.
CH471140 Genomic DNA Translation: EAX07941.1
BC040107 mRNA Translation: AAH40107.1
BC105808 mRNA Translation: AAI05809.1
CCDSiCCDS47599.1 [O75575-2]
CCDS47600.1 [O75575-4]
CCDS55116.1 [O75575-3]
CCDS5532.1 [O75575-1]
RefSeqiNP_001035737.1, NM_001040647.1 [O75575-2]
NP_001035738.1, NM_001040648.1 [O75575-4]
NP_001135886.1, NM_001142414.1 [O75575-3]
NP_055293.1, NM_014478.4 [O75575-1]
UniGeneiHs.300684

3D structure databases

ProteinModelPortaliO75575
SMRiO75575
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118121, 27 interactors
IntActiO75575, 10 interactors
STRINGi9606.ENSP00000378736

PTM databases

iPTMnetiO75575
PhosphoSitePlusiO75575

Polymorphism and mutation databases

BioMutaiCRCP

Proteomic databases

EPDiO75575
MaxQBiO75575
PaxDbiO75575
PeptideAtlasiO75575
PRIDEiO75575
ProteomicsDBi50092
50093 [O75575-2]
50094 [O75575-3]

Protocols and materials databases

DNASUi27297
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338592; ENSP00000340044; ENSG00000241258 [O75575-2]
ENST00000395326; ENSP00000378736; ENSG00000241258 [O75575-1]
ENST00000398684; ENSP00000381674; ENSG00000241258 [O75575-4]
ENST00000431089; ENSP00000388653; ENSG00000241258 [O75575-3]
GeneIDi27297
KEGGihsa:27297
UCSCiuc003tus.4 human [O75575-1]

Organism-specific databases

CTDi27297
DisGeNETi27297
EuPathDBiHostDB:ENSG00000241258.6
GeneCardsiCRCP
HGNCiHGNC:17888 CRCP
HPAiHPA007216
MIMi606121 gene
neXtProtiNX_O75575
OpenTargetsiENSG00000241258
PharmGKBiPA164718123
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4168 Eukaryota
ENOG4111TUG LUCA
GeneTreeiENSGT00390000014189
HOGENOMiHOG000244081
HOVERGENiHBG023697
InParanoidiO75575
OMAiNKHSTGQ
OrthoDBiEOG091G0ZNH
PhylomeDBiO75575
TreeFamiTF323294

Enzyme and pathway databases

ReactomeiR-HSA-1834949 Cytosolic sensors of pathogen-associated DNA
R-HSA-73780 RNA Polymerase III Chain Elongation
R-HSA-73980 RNA Polymerase III Transcription Termination
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
R-HSA-76061 RNA Polymerase III Transcription Initiation From Type 1 Promoter
R-HSA-76066 RNA Polymerase III Transcription Initiation From Type 2 Promoter
R-HSA-76071 RNA Polymerase III Transcription Initiation From Type 3 Promoter

Miscellaneous databases

ChiTaRSiCRCP human
GeneWikiiRCP9
GenomeRNAii27297
PROiPR:O75575
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000241258 Expressed in 213 organ(s), highest expression level in frontal cortex
ExpressionAtlasiO75575 baseline and differential
GenevisibleiO75575 HS

Family and domain databases

Gene3Di1.20.1250.40, 1 hit
InterProiView protein in InterPro
IPR010997 HRDC-like_sf
IPR006590 RNA_pol_Rpb4/RPC9_core
IPR005574 RPB4/RPC9
IPR038324 Rpb4/RPC9_sf
IPR038846 RPC9
PANTHERiPTHR15561 PTHR15561, 1 hit
PfamiView protein in Pfam
PF03874 RNA_pol_Rpb4, 1 hit
SMARTiView protein in SMART
SM00657 RPOL4c, 1 hit
SUPFAMiSSF47819 SSF47819, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRPC9_HUMAN
AccessioniPrimary (citable) accession number: O75575
Secondary accession number(s): A8MUZ4
, A8MW23, B2R4H4, B4E198, Q3KRA3, Q5HYF1, Q8IXL4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: November 1, 1998
Last modified: November 7, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again