Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cold shock domain-containing protein E1

Gene

CSDE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • male gonad development Source: ProtInc
  • nuclear-transcribed mRNA catabolic process, no-go decay Source: UniProtKB
  • regulation of transcription, DNA-templated Source: InterPro

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cold shock domain-containing protein E1
Alternative name(s):
N-ras upstream gene protein
Protein UNR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CSDE1
Synonyms:D1S155E, KIAA0885, NRU, UNR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000009307.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29905 CSDE1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
191510 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75534

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7812

Open Targets

More...
OpenTargetsi
ENSG00000009307

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672072

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CSDE1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001003481 – 798Cold shock domain-containing protein E1Add BLAST798

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei81N6-acetyllysineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki91Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei123PhosphoserineCombined sources1
Modified residuei276PhosphoserineCombined sources1
Modified residuei514PhosphoserineCombined sources1
Modified residuei584PhosphoserineCombined sources1
Modified residuei761PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75534

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75534

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75534

PeptideAtlas

More...
PeptideAtlasi
O75534

PRoteomics IDEntifications database

More...
PRIDEi
O75534

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50073
50074 [O75534-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75534

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75534

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000009307 Expressed in 239 organ(s), highest expression level in skeletal muscle tissue of rectus abdominis

CleanEx database of gene expression profiles

More...
CleanExi
HS_CSDE1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75534 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75534 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA018846
HPA052221

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a multi subunit autoregulatory ribonucleoprotein complex (ARC), at least composed of IGF2BP1, PABPC1 and CSDE1. Interacts with STRAP. Part of a complex associated with the FOS mCRD domain and consisting of PABPC1, PAIP1, HNRPD and SYNCRIP. The interaction with PABPC1 is direct and RNA-independent.4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113583, 50 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1076 mCRD-poly(A)-bridging complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O75534

Protein interaction database and analysis system

More...
IntActi
O75534, 27 interactors

Molecular INTeraction database

More...
MINTi
O75534

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000407724

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1798
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75534

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75534

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O75534

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini26 – 87CSD 1Add BLAST62
Domaini136 – 179CSD 2; truncatedAdd BLAST44
Domaini186 – 245CSD 3Add BLAST60
Domaini297 – 337CSD 4; truncatedAdd BLAST41
Domaini349 – 410CSD 5Add BLAST62
Domaini447 – 507CSD 6Add BLAST61
Domaini519 – 579CSD 7Add BLAST61
Domaini610 – 670CSD 8Add BLAST61
Domaini674 – 735CSD 9Add BLAST62

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IF27 Eukaryota
ENOG410ZH8Y LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000016950

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000013035

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG013042

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75534

Identification of Orthologs from Complete Genome Data

More...
OMAi
SIGMFDA

Database of Orthologous Groups

More...
OrthoDBi
EOG091G053Z

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75534

TreeFam database of animal gene trees

More...
TreeFami
TF324707

Family and domain databases

Conserved Domains Database

More...
CDDi
cd04458 CSP_CDS, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019844 Cold-shock_CS
IPR011129 CSD
IPR002059 CSP_DNA-bd
IPR012340 NA-bd_OB-fold
IPR024642 SUZ-C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00313 CSD, 5 hits
PF12901 SUZ-C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00357 CSP, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50249 SSF50249, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00352 CSD_1, 4 hits
PS51857 CSD_2, 9 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75534-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSFDPNLLHN NGHNGYPNGT SAALRETGVI EKLLTSYGFI QCSERQARLF
60 70 80 90 100
FHCSQYNGNL QDLKVGDDVE FEVSSDRRTG KPIAVKLVKI KQEILPEERM
110 120 130 140 150
NGQVVCAVPH NLESKSPAAP GQSPTGSVCY ERNGEVFYLT YTPEDVEGNV
160 170 180 190 200
QLETGDKINF VIDNNKHTGA VSARNIMLLK KKQARCQGVV CAMKEAFGFI
210 220 230 240 250
ERGDVVKEIF FHYSEFKGDL ETLQPGDDVE FTIKDRNGKE VATDVRLLPQ
260 270 280 290 300
GTVIFEDISI EHFEGTVTKV IPKVPSKNQN DPLPGRIKVD FVIPKELPFG
310 320 330 340 350
DKDTKSKVTL LEGDHVRFNI STDRRDKLER ATNIEVLSNT FQFTNEAREM
360 370 380 390 400
GVIAAMRDGF GFIKCVDRDV RMFFHFSEIL DGNQLHIADE VEFTVVPDML
410 420 430 440 450
SAQRNHAIRI KKLPKGTVSF HSHSDHRFLG TVEKEATFSN PKTTSPNKGK
460 470 480 490 500
EKEAEDGIIA YDDCGVKLTI AFQAKDVEGS TSPQIGDKVE FSISDKQRPG
510 520 530 540 550
QQVATCVRLL GRNSNSKRLL GYVATLKDNF GFIETANHDK EIFFHYSEFS
560 570 580 590 600
GDVDSLELGD MVEYSLSKGK GNKVSAEKVN KTHSVNGITE EADPTIYSGK
610 620 630 640 650
VIRPLRSVDP TQTEYQGMIE IVEEGDMKGE VYPFGIVGMA NKGDCLQKGE
660 670 680 690 700
SVKFQLCVLG QNAQTMAYNI TPLRRATVEC VKDQFGFINY EVGDSKKLFF
710 720 730 740 750
HVKEVQDGIE LQAGDEVEFS VILNQRTGKC SACNVWRVCE GPKAVAAPRP
760 770 780 790
DRLVNRLKNI TLDDASAPRL MVLRQPRGPD NSMGFGAERK IRQAGVID
Length:798
Mass (Da):88,885
Last modified:December 1, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2BD0B32F33D454DA
GO
Isoform 2 (identifier: O75534-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-134: Missing.

Note: No experimental confirmation available.
Show »
Length:767
Mass (Da):85,747
Checksum:iA18690E29F04023F
GO
Isoform 3 (identifier: O75534-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MENVFTVSSDPHPSPAAPPSLSLPLSSSSTSSGTKKQKRTPTYQRSM
     104-134: Missing.

Note: No experimental confirmation available.
Show »
Length:813
Mass (Da):90,605
Checksum:i676BE7B660D395F5
GO
Isoform 4 (identifier: O75534-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MENVFTVSSDPHPSPAAPPSLSLPLSSSSTSSGTKKQKRTPTYQRSM

Show »
Length:844
Mass (Da):93,742
Checksum:i6038A89D02384C0E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PLT0E9PLT0_HUMAN
Cold shock domain-containing protei...
CSDE1
668Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNG3E9PNG3_HUMAN
Cold shock domain-containing protei...
CSDE1
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLD4E9PLD4_HUMAN
Cold shock domain-containing protei...
CSDE1
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKN4E9PKN4_HUMAN
Cold shock domain-containing protei...
CSDE1
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJK7E9PJK7_HUMAN
Cold shock domain-containing protei...
CSDE1
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1Y8EMC9A0A1Y8EMC9_HUMAN
Cold shock domain-containing protei...
CSDE1
7Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA74908 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAH18231 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti31E → G in AAD27787 (PubMed:10931946).Curated1
Sequence conflicti92 – 95QEIL → TRNP in AAD27787 (PubMed:10931946).Curated4
Sequence conflicti152L → P in CAH18231 (PubMed:17974005).Curated1
Sequence conflicti243T → P in AAD27787 (PubMed:10931946).Curated1
Sequence conflicti276S → G in CAH18269 (PubMed:17974005).Curated1
Sequence conflicti299F → L in CAH18269 (PubMed:17974005).Curated1
Sequence conflicti363 – 385IKCVD…DGNQL → HPSVWIRECSVCSFPLPVKF WMGTSS in AAD27787 (PubMed:10931946).CuratedAdd BLAST23
Sequence conflicti608V → I in CAH18269 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0456151M → MENVFTVSSDPHPSPAAPPS LSLPLSSSSTSSGTKKQKRT PTYQRSM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_001138104 – 134Missing in isoform 2 and isoform 3. 5 PublicationsAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF077054 mRNA Translation: AAD27787.1
AB020692 mRNA Translation: BAA74908.2 Different initiation.
AK290146 mRNA Translation: BAF82835.1
CR749378 mRNA Translation: CAH18231.1 Different initiation.
CR749431 mRNA Translation: CAH18269.1
AL096773 Genomic DNA No translation available.
CH471122 Genomic DNA Translation: EAW56612.1
CH471122 Genomic DNA Translation: EAW56616.1
BC032446 mRNA Translation: AAH32446.1
AF070542 mRNA Translation: AAC28634.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30811.1 [O75534-2]
CCDS30812.1 [O75534-1]
CCDS44197.1 [O75534-3]
CCDS55626.1 [O75534-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
S29815

NCBI Reference Sequences

More...
RefSeqi
NP_001007554.1, NM_001007553.2 [O75534-1]
NP_001123995.1, NM_001130523.2 [O75534-3]
NP_001229820.1, NM_001242891.1 [O75534-4]
NP_001229821.1, NM_001242892.1 [O75534-1]
NP_001229822.1, NM_001242893.1 [O75534-2]
NP_009089.4, NM_007158.5 [O75534-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.69855
Hs.731496

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261443; ENSP00000261443; ENSG00000009307 [O75534-2]
ENST00000339438; ENSP00000342408; ENSG00000009307 [O75534-2]
ENST00000358528; ENSP00000351329; ENSG00000009307 [O75534-1]
ENST00000369530; ENSP00000358543; ENSG00000009307 [O75534-3]
ENST00000438362; ENSP00000407724; ENSG00000009307 [O75534-4]
ENST00000534699; ENSP00000432958; ENSG00000009307 [O75534-1]
ENST00000610726; ENSP00000481762; ENSG00000009307 [O75534-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7812

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7812

UCSC genome browser

More...
UCSCi
uc001efi.4 human [O75534-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF077054 mRNA Translation: AAD27787.1
AB020692 mRNA Translation: BAA74908.2 Different initiation.
AK290146 mRNA Translation: BAF82835.1
CR749378 mRNA Translation: CAH18231.1 Different initiation.
CR749431 mRNA Translation: CAH18269.1
AL096773 Genomic DNA No translation available.
CH471122 Genomic DNA Translation: EAW56612.1
CH471122 Genomic DNA Translation: EAW56616.1
BC032446 mRNA Translation: AAH32446.1
AF070542 mRNA Translation: AAC28634.1
CCDSiCCDS30811.1 [O75534-2]
CCDS30812.1 [O75534-1]
CCDS44197.1 [O75534-3]
CCDS55626.1 [O75534-4]
PIRiS29815
RefSeqiNP_001007554.1, NM_001007553.2 [O75534-1]
NP_001123995.1, NM_001130523.2 [O75534-3]
NP_001229820.1, NM_001242891.1 [O75534-4]
NP_001229821.1, NM_001242892.1 [O75534-1]
NP_001229822.1, NM_001242893.1 [O75534-2]
NP_009089.4, NM_007158.5 [O75534-2]
UniGeneiHs.69855
Hs.731496

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WFQNMR-A15-90[»]
1X65NMR-A348-423[»]
2YTVNMR-A673-738[»]
2YTXNMR-A175-258[»]
2YTYNMR-A508-582[»]
ProteinModelPortaliO75534
SMRiO75534
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113583, 50 interactors
ComplexPortaliCPX-1076 mCRD-poly(A)-bridging complex
CORUMiO75534
IntActiO75534, 27 interactors
MINTiO75534
STRINGi9606.ENSP00000407724

PTM databases

iPTMnetiO75534
PhosphoSitePlusiO75534

Polymorphism and mutation databases

BioMutaiCSDE1

Proteomic databases

EPDiO75534
MaxQBiO75534
PaxDbiO75534
PeptideAtlasiO75534
PRIDEiO75534
ProteomicsDBi50073
50074 [O75534-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7812
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261443; ENSP00000261443; ENSG00000009307 [O75534-2]
ENST00000339438; ENSP00000342408; ENSG00000009307 [O75534-2]
ENST00000358528; ENSP00000351329; ENSG00000009307 [O75534-1]
ENST00000369530; ENSP00000358543; ENSG00000009307 [O75534-3]
ENST00000438362; ENSP00000407724; ENSG00000009307 [O75534-4]
ENST00000534699; ENSP00000432958; ENSG00000009307 [O75534-1]
ENST00000610726; ENSP00000481762; ENSG00000009307 [O75534-4]
GeneIDi7812
KEGGihsa:7812
UCSCiuc001efi.4 human [O75534-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7812
DisGeNETi7812
EuPathDBiHostDB:ENSG00000009307.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CSDE1
HGNCiHGNC:29905 CSDE1
HPAiHPA018846
HPA052221
MIMi191510 gene
neXtProtiNX_O75534
OpenTargetsiENSG00000009307
PharmGKBiPA142672072

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IF27 Eukaryota
ENOG410ZH8Y LUCA
GeneTreeiENSGT00390000016950
HOGENOMiHOG000013035
HOVERGENiHBG013042
InParanoidiO75534
OMAiSIGMFDA
OrthoDBiEOG091G053Z
PhylomeDBiO75534
TreeFamiTF324707

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CSDE1 human
EvolutionaryTraceiO75534

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CSDE1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7812

Protein Ontology

More...
PROi
PR:O75534

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000009307 Expressed in 239 organ(s), highest expression level in skeletal muscle tissue of rectus abdominis
CleanExiHS_CSDE1
ExpressionAtlasiO75534 baseline and differential
GenevisibleiO75534 HS

Family and domain databases

CDDicd04458 CSP_CDS, 2 hits
InterProiView protein in InterPro
IPR019844 Cold-shock_CS
IPR011129 CSD
IPR002059 CSP_DNA-bd
IPR012340 NA-bd_OB-fold
IPR024642 SUZ-C
PfamiView protein in Pfam
PF00313 CSD, 5 hits
PF12901 SUZ-C, 1 hit
SMARTiView protein in SMART
SM00357 CSP, 5 hits
SUPFAMiSSF50249 SSF50249, 5 hits
PROSITEiView protein in PROSITE
PS00352 CSD_1, 4 hits
PS51857 CSD_2, 9 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCSDE1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75534
Secondary accession number(s): A8K281
, E9PGZ0, G5E9Q2, O94961, Q5TF04, Q5TF05, Q68DF1, Q68DI9, Q9Y2S4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 1, 2000
Last modified: November 7, 2018
This is version 189 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again