Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cold shock domain-containing protein E1

Gene

CSDE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.2 Publications

GO - Molecular functioni

GO - Biological processi

  • male gonad development Source: ProtInc
  • nuclear-transcribed mRNA catabolic process, no-go decay Source: UniProtKB
  • regulation of transcription, DNA-templated Source: InterPro

Keywordsi

Molecular functionRNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cold shock domain-containing protein E1
Alternative name(s):
N-ras upstream gene protein
Protein UNR
Gene namesi
Name:CSDE1
Synonyms:D1S155E, KIAA0885, NRU, UNR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000009307.15
HGNCiHGNC:29905 CSDE1
MIMi191510 gene
neXtProtiNX_O75534

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi7812
OpenTargetsiENSG00000009307
PharmGKBiPA142672072

Polymorphism and mutation databases

BioMutaiCSDE1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001003481 – 798Cold shock domain-containing protein E1Add BLAST798

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei81N6-acetyllysineCombined sources1
Cross-linki91Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei123PhosphoserineCombined sources1
Modified residuei276PhosphoserineCombined sources1
Modified residuei514PhosphoserineCombined sources1
Modified residuei584PhosphoserineCombined sources1
Modified residuei761PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO75534
MaxQBiO75534
PaxDbiO75534
PeptideAtlasiO75534
PRIDEiO75534
ProteomicsDBi50073
50074 [O75534-2]

PTM databases

iPTMnetiO75534
PhosphoSitePlusiO75534

Expressioni

Gene expression databases

BgeeiENSG00000009307 Expressed in 239 organ(s), highest expression level in skeletal muscle tissue of rectus abdominis
CleanExiHS_CSDE1
ExpressionAtlasiO75534 baseline and differential
GenevisibleiO75534 HS

Organism-specific databases

HPAiHPA018846
HPA052221

Interactioni

Subunit structurei

Component of a multi subunit autoregulatory ribonucleoprotein complex (ARC), at least composed of IGF2BP1, PABPC1 and CSDE1. Interacts with STRAP. Part of a complex associated with the FOS mCRD domain and consisting of PABPC1, PAIP1, HNRPD and SYNCRIP. The interaction with PABPC1 is direct and RNA-independent.4 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi113583, 50 interactors
ComplexPortaliCPX-1076 mCRD-poly(A)-bridging complex
CORUMiO75534
IntActiO75534, 27 interactors
MINTiO75534
STRINGi9606.ENSP00000407724

Structurei

Secondary structure

1798
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO75534
SMRiO75534
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75534

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 87CSD 1Add BLAST62
Domaini136 – 179CSD 2; truncatedAdd BLAST44
Domaini186 – 245CSD 3Add BLAST60
Domaini297 – 337CSD 4; truncatedAdd BLAST41
Domaini349 – 410CSD 5Add BLAST62
Domaini447 – 507CSD 6Add BLAST61
Domaini519 – 579CSD 7Add BLAST61
Domaini610 – 670CSD 8Add BLAST61
Domaini674 – 735CSD 9Add BLAST62

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IF27 Eukaryota
ENOG410ZH8Y LUCA
GeneTreeiENSGT00390000016950
HOGENOMiHOG000013035
HOVERGENiHBG013042
InParanoidiO75534
OMAiSIGMFDA
OrthoDBiEOG091G053Z
PhylomeDBiO75534
TreeFamiTF324707

Family and domain databases

CDDicd04458 CSP_CDS, 2 hits
InterProiView protein in InterPro
IPR019844 Cold-shock_CS
IPR011129 CSD
IPR002059 CSP_DNA-bd
IPR012340 NA-bd_OB-fold
IPR024642 SUZ-C
PfamiView protein in Pfam
PF00313 CSD, 5 hits
PF12901 SUZ-C, 1 hit
SMARTiView protein in SMART
SM00357 CSP, 5 hits
SUPFAMiSSF50249 SSF50249, 5 hits
PROSITEiView protein in PROSITE
PS00352 CSD_1, 4 hits
PS51857 CSD_2, 9 hits

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75534-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSFDPNLLHN NGHNGYPNGT SAALRETGVI EKLLTSYGFI QCSERQARLF
60 70 80 90 100
FHCSQYNGNL QDLKVGDDVE FEVSSDRRTG KPIAVKLVKI KQEILPEERM
110 120 130 140 150
NGQVVCAVPH NLESKSPAAP GQSPTGSVCY ERNGEVFYLT YTPEDVEGNV
160 170 180 190 200
QLETGDKINF VIDNNKHTGA VSARNIMLLK KKQARCQGVV CAMKEAFGFI
210 220 230 240 250
ERGDVVKEIF FHYSEFKGDL ETLQPGDDVE FTIKDRNGKE VATDVRLLPQ
260 270 280 290 300
GTVIFEDISI EHFEGTVTKV IPKVPSKNQN DPLPGRIKVD FVIPKELPFG
310 320 330 340 350
DKDTKSKVTL LEGDHVRFNI STDRRDKLER ATNIEVLSNT FQFTNEAREM
360 370 380 390 400
GVIAAMRDGF GFIKCVDRDV RMFFHFSEIL DGNQLHIADE VEFTVVPDML
410 420 430 440 450
SAQRNHAIRI KKLPKGTVSF HSHSDHRFLG TVEKEATFSN PKTTSPNKGK
460 470 480 490 500
EKEAEDGIIA YDDCGVKLTI AFQAKDVEGS TSPQIGDKVE FSISDKQRPG
510 520 530 540 550
QQVATCVRLL GRNSNSKRLL GYVATLKDNF GFIETANHDK EIFFHYSEFS
560 570 580 590 600
GDVDSLELGD MVEYSLSKGK GNKVSAEKVN KTHSVNGITE EADPTIYSGK
610 620 630 640 650
VIRPLRSVDP TQTEYQGMIE IVEEGDMKGE VYPFGIVGMA NKGDCLQKGE
660 670 680 690 700
SVKFQLCVLG QNAQTMAYNI TPLRRATVEC VKDQFGFINY EVGDSKKLFF
710 720 730 740 750
HVKEVQDGIE LQAGDEVEFS VILNQRTGKC SACNVWRVCE GPKAVAAPRP
760 770 780 790
DRLVNRLKNI TLDDASAPRL MVLRQPRGPD NSMGFGAERK IRQAGVID
Length:798
Mass (Da):88,885
Last modified:December 1, 2000 - v2
Checksum:i2BD0B32F33D454DA
GO
Isoform 2 (identifier: O75534-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-134: Missing.

Note: No experimental confirmation available.
Show »
Length:767
Mass (Da):85,747
Checksum:iA18690E29F04023F
GO
Isoform 3 (identifier: O75534-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MENVFTVSSDPHPSPAAPPSLSLPLSSSSTSSGTKKQKRTPTYQRSM
     104-134: Missing.

Note: No experimental confirmation available.
Show »
Length:813
Mass (Da):90,605
Checksum:i676BE7B660D395F5
GO
Isoform 4 (identifier: O75534-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MENVFTVSSDPHPSPAAPPSLSLPLSSSSTSSGTKKQKRTPTYQRSM

Show »
Length:844
Mass (Da):93,742
Checksum:i6038A89D02384C0E
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PLT0E9PLT0_HUMAN
Cold shock domain-containing protei...
CSDE1
668Annotation score:
E9PNG3E9PNG3_HUMAN
Cold shock domain-containing protei...
CSDE1
136Annotation score:
E9PLD4E9PLD4_HUMAN
Cold shock domain-containing protei...
CSDE1
94Annotation score:
E9PKN4E9PKN4_HUMAN
Cold shock domain-containing protei...
CSDE1
46Annotation score:
E9PJK7E9PJK7_HUMAN
Cold shock domain-containing protei...
CSDE1
36Annotation score:
A0A1Y8EMC9A0A1Y8EMC9_HUMAN
Cold shock domain-containing protei...
CSDE1
7Annotation score:

Sequence cautioni

The sequence BAA74908 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAH18231 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti31E → G in AAD27787 (PubMed:10931946).Curated1
Sequence conflicti92 – 95QEIL → TRNP in AAD27787 (PubMed:10931946).Curated4
Sequence conflicti152L → P in CAH18231 (PubMed:17974005).Curated1
Sequence conflicti243T → P in AAD27787 (PubMed:10931946).Curated1
Sequence conflicti276S → G in CAH18269 (PubMed:17974005).Curated1
Sequence conflicti299F → L in CAH18269 (PubMed:17974005).Curated1
Sequence conflicti363 – 385IKCVD…DGNQL → HPSVWIRECSVCSFPLPVKF WMGTSS in AAD27787 (PubMed:10931946).CuratedAdd BLAST23
Sequence conflicti608V → I in CAH18269 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0456151M → MENVFTVSSDPHPSPAAPPS LSLPLSSSSTSSGTKKQKRT PTYQRSM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_001138104 – 134Missing in isoform 2 and isoform 3. 5 PublicationsAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF077054 mRNA Translation: AAD27787.1
AB020692 mRNA Translation: BAA74908.2 Different initiation.
AK290146 mRNA Translation: BAF82835.1
CR749378 mRNA Translation: CAH18231.1 Different initiation.
CR749431 mRNA Translation: CAH18269.1
AL096773 Genomic DNA No translation available.
CH471122 Genomic DNA Translation: EAW56612.1
CH471122 Genomic DNA Translation: EAW56616.1
BC032446 mRNA Translation: AAH32446.1
AF070542 mRNA Translation: AAC28634.1
CCDSiCCDS30811.1 [O75534-2]
CCDS30812.1 [O75534-1]
CCDS44197.1 [O75534-3]
CCDS55626.1 [O75534-4]
PIRiS29815
RefSeqiNP_001007554.1, NM_001007553.2 [O75534-1]
NP_001123995.1, NM_001130523.2 [O75534-3]
NP_001229820.1, NM_001242891.1 [O75534-4]
NP_001229821.1, NM_001242892.1 [O75534-1]
NP_001229822.1, NM_001242893.1 [O75534-2]
NP_009089.4, NM_007158.5 [O75534-2]
UniGeneiHs.69855
Hs.731496

Genome annotation databases

EnsembliENST00000261443; ENSP00000261443; ENSG00000009307 [O75534-2]
ENST00000339438; ENSP00000342408; ENSG00000009307 [O75534-2]
ENST00000358528; ENSP00000351329; ENSG00000009307 [O75534-1]
ENST00000369530; ENSP00000358543; ENSG00000009307 [O75534-3]
ENST00000438362; ENSP00000407724; ENSG00000009307 [O75534-4]
ENST00000534699; ENSP00000432958; ENSG00000009307 [O75534-1]
ENST00000610726; ENSP00000481762; ENSG00000009307 [O75534-4]
GeneIDi7812
KEGGihsa:7812
UCSCiuc001efi.4 human [O75534-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF077054 mRNA Translation: AAD27787.1
AB020692 mRNA Translation: BAA74908.2 Different initiation.
AK290146 mRNA Translation: BAF82835.1
CR749378 mRNA Translation: CAH18231.1 Different initiation.
CR749431 mRNA Translation: CAH18269.1
AL096773 Genomic DNA No translation available.
CH471122 Genomic DNA Translation: EAW56612.1
CH471122 Genomic DNA Translation: EAW56616.1
BC032446 mRNA Translation: AAH32446.1
AF070542 mRNA Translation: AAC28634.1
CCDSiCCDS30811.1 [O75534-2]
CCDS30812.1 [O75534-1]
CCDS44197.1 [O75534-3]
CCDS55626.1 [O75534-4]
PIRiS29815
RefSeqiNP_001007554.1, NM_001007553.2 [O75534-1]
NP_001123995.1, NM_001130523.2 [O75534-3]
NP_001229820.1, NM_001242891.1 [O75534-4]
NP_001229821.1, NM_001242892.1 [O75534-1]
NP_001229822.1, NM_001242893.1 [O75534-2]
NP_009089.4, NM_007158.5 [O75534-2]
UniGeneiHs.69855
Hs.731496

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WFQNMR-A15-90[»]
1X65NMR-A348-423[»]
2YTVNMR-A673-738[»]
2YTXNMR-A175-258[»]
2YTYNMR-A508-582[»]
ProteinModelPortaliO75534
SMRiO75534
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113583, 50 interactors
ComplexPortaliCPX-1076 mCRD-poly(A)-bridging complex
CORUMiO75534
IntActiO75534, 27 interactors
MINTiO75534
STRINGi9606.ENSP00000407724

PTM databases

iPTMnetiO75534
PhosphoSitePlusiO75534

Polymorphism and mutation databases

BioMutaiCSDE1

Proteomic databases

EPDiO75534
MaxQBiO75534
PaxDbiO75534
PeptideAtlasiO75534
PRIDEiO75534
ProteomicsDBi50073
50074 [O75534-2]

Protocols and materials databases

DNASUi7812
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261443; ENSP00000261443; ENSG00000009307 [O75534-2]
ENST00000339438; ENSP00000342408; ENSG00000009307 [O75534-2]
ENST00000358528; ENSP00000351329; ENSG00000009307 [O75534-1]
ENST00000369530; ENSP00000358543; ENSG00000009307 [O75534-3]
ENST00000438362; ENSP00000407724; ENSG00000009307 [O75534-4]
ENST00000534699; ENSP00000432958; ENSG00000009307 [O75534-1]
ENST00000610726; ENSP00000481762; ENSG00000009307 [O75534-4]
GeneIDi7812
KEGGihsa:7812
UCSCiuc001efi.4 human [O75534-1]

Organism-specific databases

CTDi7812
DisGeNETi7812
EuPathDBiHostDB:ENSG00000009307.15
GeneCardsiCSDE1
HGNCiHGNC:29905 CSDE1
HPAiHPA018846
HPA052221
MIMi191510 gene
neXtProtiNX_O75534
OpenTargetsiENSG00000009307
PharmGKBiPA142672072
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IF27 Eukaryota
ENOG410ZH8Y LUCA
GeneTreeiENSGT00390000016950
HOGENOMiHOG000013035
HOVERGENiHBG013042
InParanoidiO75534
OMAiSIGMFDA
OrthoDBiEOG091G053Z
PhylomeDBiO75534
TreeFamiTF324707

Miscellaneous databases

ChiTaRSiCSDE1 human
EvolutionaryTraceiO75534
GeneWikiiCSDE1
GenomeRNAii7812
PROiPR:O75534
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000009307 Expressed in 239 organ(s), highest expression level in skeletal muscle tissue of rectus abdominis
CleanExiHS_CSDE1
ExpressionAtlasiO75534 baseline and differential
GenevisibleiO75534 HS

Family and domain databases

CDDicd04458 CSP_CDS, 2 hits
InterProiView protein in InterPro
IPR019844 Cold-shock_CS
IPR011129 CSD
IPR002059 CSP_DNA-bd
IPR012340 NA-bd_OB-fold
IPR024642 SUZ-C
PfamiView protein in Pfam
PF00313 CSD, 5 hits
PF12901 SUZ-C, 1 hit
SMARTiView protein in SMART
SM00357 CSP, 5 hits
SUPFAMiSSF50249 SSF50249, 5 hits
PROSITEiView protein in PROSITE
PS00352 CSD_1, 4 hits
PS51857 CSD_2, 9 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCSDE1_HUMAN
AccessioniPrimary (citable) accession number: O75534
Secondary accession number(s): A8K281
, E9PGZ0, G5E9Q2, O94961, Q5TF04, Q5TF05, Q68DF1, Q68DI9, Q9Y2S4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: December 1, 2000
Last modified: November 7, 2018
This is version 189 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again