Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription initiation protein SPT3 homolog

Gene

SUPT3H

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable transcriptional activator.1 Publication

GO - Molecular functioni

  • DNA binding Source: GO_Central
  • protein heterodimerization activity Source: InterPro
  • transcription coactivator activity Source: UniProtKB
  • transcription coregulator activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription initiation protein SPT3 homolog
Alternative name(s):
SPT3-like protein
Gene namesi
Name:SUPT3H
Synonyms:SPT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000196284.13
HGNCiHGNC:11466 SUPT3H
MIMi602947 gene
neXtProtiNX_O75486

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8464
OpenTargetsiENSG00000196284
PharmGKBiPA36252

Polymorphism and mutation databases

BioMutaiSUPT3H

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000723131 – 317Transcription initiation protein SPT3 homologAdd BLAST317

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Cross-linki112Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki163Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiO75486
MaxQBiO75486
PaxDbiO75486
PeptideAtlasiO75486
PRIDEiO75486
ProteomicsDBi50042

PTM databases

iPTMnetiO75486
PhosphoSitePlusiO75486

Expressioni

Tissue specificityi

Expressed in all tissues tested including pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.

Gene expression databases

BgeeiENSG00000196284 Expressed in 162 organ(s), highest expression level in corpus callosum
CleanExiHS_SUPT3H
ExpressionAtlasiO75486 baseline and differential
GenevisibleiO75486 HS

Organism-specific databases

HPAiHPA024371

Interactioni

Subunit structurei

Component of the PCAF complex, at least composed of TADA2L/ADA2, SUPT3H, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Associates with TAFII31 and GCN5L2. Component of the TFTC-HAT complex, at least composed of TAF5L, TAF6L, TADA3L, SUPT3H/SPT3, TAF2/TAFII150, TAF4/TAFII135, TAF5/TAFII100, GCN5L2/GCN5, TAF10 and TRRAP. Component of the STAGA transcription coactivator-HAT complex, at least composed of SUPT3H, GCN5L2, TAF5L, TAF6L, SUPT7L, TADA3L, TAD1L, TAF10, TAF12, TRRAP and TAF9. The STAGA core complex is associated with a subcomplex required for histone deubiquitination composed of ATXN7L3, ENY2 and USP22.4 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114042, 36 interactors
ComplexPortaliCPX-900 SAGA complex
CPX-903 TFTC histone acetylation complex
CPX-989 PCAF histone acetylase complex
CORUMiO75486
DIPiDIP-28148N
IntActiO75486, 5 interactors
STRINGi9606.ENSP00000360515

Structurei

3D structure databases

ProteinModelPortaliO75486
SMRiO75486
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SPT3 family.Curated

Phylogenomic databases

eggNOGiKOG3902 Eukaryota
ENOG410Z86C LUCA
GeneTreeiENSGT00390000010738
HOGENOMiHOG000294119
HOVERGENiHBG058560
InParanoidiO75486
OMAiMRNHPVK
OrthoDBiEOG091G0NTZ
PhylomeDBiO75486
TreeFamiTF323574

Family and domain databases

CDDicd07978 TAF13, 1 hit
Gene3Di1.10.20.10, 1 hit
InterProiView protein in InterPro
IPR009072 Histone-fold
IPR003195 TFIID_TAF13
PANTHERiPTHR11380 PTHR11380, 1 hit
PfamiView protein in Pfam
PF02269 TFIID-18kDa, 1 hit
SUPFAMiSSF47113 SSF47113, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O75486-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNNTAASPMS TATSSSGRST GKSISFATEL QSMMYSLGDA RRPLHETAVL
60 70 80 90 100
VEDVVHTQLI NLLQQAAEVS QLRGARVITP EDLLFLMRKD KKKLRRLLKY
110 120 130 140 150
MFIRDYKSKI VKGIDEDDLL EDKLSGSNNA NKRQKIAQDF LNSIDQTGEL
160 170 180 190 200
LAMFEDDEID EVKQERMERA ERQTRIMDSA QYAEFCESRQ LSFSKKASKF
210 220 230 240 250
RDWLDCSSME IKPNVVAMEI LAYLAYETVA QLVDLALLVR QDMVTKAGDP
260 270 280 290 300
FSHAISATFI QYHNSAESTA ACGVEAHSDA IQPCHIREAI RRYSHRIGPL
310
SPFTNAYRRN GMAFLAC
Length:317
Mass (Da):35,793
Last modified:March 28, 2018 - v3
Checksum:iAF339954A57DB5A6
GO
Isoform 2 (identifier: O75486-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MNNTAASPMSTATSSSGRSTGKSISFATELQSMM → MVVFGTTFFN...ILPLLNDSGR

Show »
Length:328
Mass (Da):37,427
Checksum:i3E2B1193CD0C5393
GO

Sequence cautioni

The sequence AAC70014 differs from that shown. Chimeric cDNA.Curated
The sequence AAC70014 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence AAC70014 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti42 – 46RPLHE → SLFMR in AAC70014 (PubMed:9787080).Curated5
Sequence conflicti173 – 175QTR → HNS in AAC70014 (PubMed:9787080).Curated3
Sequence conflicti224L → S in BAG36602 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057000242D → A. Corresponds to variant dbSNP:rs16872923Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0594961 – 34MNNTA…LQSMM → MVVFGTTFFNFDSFIGKTDS IEIIGKSVFPYCYHNILPLL NDSGR in isoform 2. Add BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064804 mRNA Translation: AAC70014.1 Sequence problems.
AF069734 mRNA Translation: AAC39904.1
AF073930 mRNA Translation: AAC36098.1
AK313874 mRNA Translation: BAG36602.1
AL096865 Genomic DNA No translation available.
AL138880 Genomic DNA No translation available.
AL161905 Genomic DNA No translation available.
AL360272 Genomic DNA No translation available.
AL499610 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04274.1
CH471081 Genomic DNA Translation: EAX04275.1
BC050384 mRNA Translation: AAH50384.1
CCDSiCCDS34465.1 [O75486-1]
CCDS34466.1 [O75486-4]
RefSeqiNP_003590.1, NM_003599.3 [O75486-1]
NP_852001.1, NM_181356.2 [O75486-4]
XP_016866860.1, XM_017011371.1 [O75486-1]
XP_016866861.1, XM_017011372.1
UniGeneiHs.368325

Genome annotation databases

EnsembliENST00000371459; ENSP00000360514; ENSG00000196284 [O75486-1]
ENST00000371460; ENSP00000360515; ENSG00000196284 [O75486-4]
ENST00000475057; ENSP00000436411; ENSG00000196284 [O75486-1]
GeneIDi8464
UCSCiuc003oxn.3 human [O75486-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064804 mRNA Translation: AAC70014.1 Sequence problems.
AF069734 mRNA Translation: AAC39904.1
AF073930 mRNA Translation: AAC36098.1
AK313874 mRNA Translation: BAG36602.1
AL096865 Genomic DNA No translation available.
AL138880 Genomic DNA No translation available.
AL161905 Genomic DNA No translation available.
AL360272 Genomic DNA No translation available.
AL499610 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX04274.1
CH471081 Genomic DNA Translation: EAX04275.1
BC050384 mRNA Translation: AAH50384.1
CCDSiCCDS34465.1 [O75486-1]
CCDS34466.1 [O75486-4]
RefSeqiNP_003590.1, NM_003599.3 [O75486-1]
NP_852001.1, NM_181356.2 [O75486-4]
XP_016866860.1, XM_017011371.1 [O75486-1]
XP_016866861.1, XM_017011372.1
UniGeneiHs.368325

3D structure databases

ProteinModelPortaliO75486
SMRiO75486
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114042, 36 interactors
ComplexPortaliCPX-900 SAGA complex
CPX-903 TFTC histone acetylation complex
CPX-989 PCAF histone acetylase complex
CORUMiO75486
DIPiDIP-28148N
IntActiO75486, 5 interactors
STRINGi9606.ENSP00000360515

PTM databases

iPTMnetiO75486
PhosphoSitePlusiO75486

Polymorphism and mutation databases

BioMutaiSUPT3H

Proteomic databases

EPDiO75486
MaxQBiO75486
PaxDbiO75486
PeptideAtlasiO75486
PRIDEiO75486
ProteomicsDBi50042

Protocols and materials databases

DNASUi8464
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371459; ENSP00000360514; ENSG00000196284 [O75486-1]
ENST00000371460; ENSP00000360515; ENSG00000196284 [O75486-4]
ENST00000475057; ENSP00000436411; ENSG00000196284 [O75486-1]
GeneIDi8464
UCSCiuc003oxn.3 human [O75486-1]

Organism-specific databases

CTDi8464
DisGeNETi8464
EuPathDBiHostDB:ENSG00000196284.13
GeneCardsiSUPT3H
HGNCiHGNC:11466 SUPT3H
HPAiHPA024371
MIMi602947 gene
neXtProtiNX_O75486
OpenTargetsiENSG00000196284
PharmGKBiPA36252
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3902 Eukaryota
ENOG410Z86C LUCA
GeneTreeiENSGT00390000010738
HOGENOMiHOG000294119
HOVERGENiHBG058560
InParanoidiO75486
OMAiMRNHPVK
OrthoDBiEOG091G0NTZ
PhylomeDBiO75486
TreeFamiTF323574

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones

Miscellaneous databases

ChiTaRSiSUPT3H human
GeneWikiiTranscription_initiation_protein_SPT3_homolog
GenomeRNAii8464
PROiPR:O75486
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000196284 Expressed in 162 organ(s), highest expression level in corpus callosum
CleanExiHS_SUPT3H
ExpressionAtlasiO75486 baseline and differential
GenevisibleiO75486 HS

Family and domain databases

CDDicd07978 TAF13, 1 hit
Gene3Di1.10.20.10, 1 hit
InterProiView protein in InterPro
IPR009072 Histone-fold
IPR003195 TFIID_TAF13
PANTHERiPTHR11380 PTHR11380, 1 hit
PfamiView protein in Pfam
PF02269 TFIID-18kDa, 1 hit
SUPFAMiSSF47113 SSF47113, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSUPT3_HUMAN
AccessioniPrimary (citable) accession number: O75486
Secondary accession number(s): A6NKG9
, B2R9Q5, O76066, Q5TAV9, Q86VN7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2002
Last sequence update: March 28, 2018
Last modified: November 7, 2018
This is version 159 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again