Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O75478 (TAD2A_HUMAN)

Entry version 203 (22 Apr 2020)
Sequence version 3 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transcriptional adapter 2-alpha

Gene

TADA2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity). Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling. May promote TP53/p53 'Lys-321' acetylation, leading to reduced TP53 stability and transcriptional activity (PubMed:22644376). May also promote XRCC6 acetylation thus facilitating cell apoptosis in response to DNA damage (PubMed:22644376).By similarity2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi426 – 435By similarity10

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-3214847 HATs acetylate histones

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcriptional adapter 2-alpha
Alternative name(s):
Transcriptional adapter 2-like
Short name:
ADA2-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TADA2A
Synonyms:TADA2L
ORF Names:KL04P
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11531 TADA2A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602276 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75478

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		6871

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36306

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75478 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TADA2A

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001970831 – 443Transcriptional adapter 2-alphaAdd BLAST443

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei6Phosphoserine; in variant Ser-6Combined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki132Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki138Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O75478

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O75478

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75478

MaxQB - The MaxQuant DataBase

More...MaxQBi		O75478

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75478

PeptideAtlas

More...PeptideAtlasi		O75478

PRoteomics IDEntifications database

More...PRIDEi		O75478

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		50040 [O75478-1]
50041 [O75478-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75478

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75478

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues, but most abundantly in testis.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GCN5 and NR3C1. Associated with the P/CAF protein in the PCAF complex.

Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP.

Component of the ADA2A-containing complex (ATAC), composed of KAT14, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1.

Interacts with CCDC134 (PubMed:22644376).

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		112734, 159 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-1004 PCAF-containing ATAC complex
CPX-989 PCAF histone acetylase complex
CPX-997 GCN5-containing ATAC complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O75478

Database of interacting proteins

More...DIPi		DIP-28151N

Protein interaction database and analysis system

More...IntActi		O75478, 59 interactors

Molecular INTeraction database

More...MINTi		O75478

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000481091

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75478 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1443
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O75478

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O75478

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini70 – 122SANTPROSITE-ProRule annotationAdd BLAST53
Domaini356 – 443SWIRMPROSITE-ProRule annotationAdd BLAST88

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi17 – 45Cys-richAdd BLAST29

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0457 Eukaryota
COG5114 LUCA

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75478

KEGG Orthology (KO)

More...KOi		K11314

Database of Orthologous Groups

More...OrthoDBi		812864at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75478

TreeFam database of animal gene trees

More...TreeFami		TF313975

Family and domain databases

Conserved Domains Database

More...CDDi		cd00167 SANT, 1 hit
cd02335 ZZ_ADA2, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR041983 ADA2-like_ZZ
IPR016827 Ada2/TADA2
IPR009057 Homeobox-like_sf
IPR001005 SANT/Myb
IPR017884 SANT_dom
IPR007526 SWIRM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00249 Myb_DNA-binding, 1 hit
PF04433 SWIRM, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF025024 Transcriptional_adaptor_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00717 SANT, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF46689 SSF46689, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51293 SANT, 1 hit
PS50934 SWIRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75478-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRLGPFSND PSDKPPCRGC SSYLMEPYIK CAECGPPPFF LCLQCFTRGF 
        60         70         80         90        100
EYKKHQSDHT YEIMTSDFPV LDPSWTAQEE MALLEAVMDC GFGNWQDVAN 
       110        120        130        140        150
QMCTKTKEEC EKHYMKHFIN NPLFASTLLN LKQAEEAKTA DTAIPFHSTD 
       160        170        180        190        200
DPPRPTFDSL LSRDMAGYMP ARADFIEEFD NYAEWDLRDI DFVEDDSDIL 
       210        220        230        240        250
HALKMAVVDI YHSRLKERQR RKKIIRDHGL INLRKFQLME RRYPKEVQDL 
       260        270        280        290        300
YETMRRFARI VGPVEHDKFI ESHALEFELR REIKRLQEYR TAGITNFCSA 
       310        320        330        340        350
RTYDHLKKTR EEERLKRTML SEVLQYIQDS SACQQWLRRQ ADIDSGLSPS 
       360        370        380        390        400
IPMASNSGRR SAPPLNLTGL PGTEKLNEKE KELCQMVRLV PGAYLEYKSA 
       410        420        430        440 
LLNECNKQGG LRLAQARALI KIDVNKTRKI YDFLIREGYI TKG
Length:443
Mass (Da):51,506
Last modified:January 11, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA4E1D87B1B3F6BA5
GO
Isoform 2 (identifier: O75478-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     275-305: LEFELRREIKRLQEYRTAGITNFCSARTYDH → CRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
     306-443: Missing.

Show »
Length:305
Mass (Da):36,054
Checksum:i51386043D3BB294C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A024R0Y4A0A024R0Y4_HUMAN
Transcriptional adapter
TADA2A TADA2L, hCG_28187
443Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWR4A0A087WWR4_HUMAN
Transcriptional adapter 2-alpha
TADA2A TADA2L, hCG_28187
305Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X2C8A0A087X2C8_HUMAN
Transcriptional adapter 2-alpha
TADA2A
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYK3A0A087WYK3_HUMAN
Transcriptional adapter 2-alpha
TADA2A
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WTV5A0A087WTV5_HUMAN
Transcriptional adapter 2-alpha
TADA2A
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WU71A0A087WU71_HUMAN
Transcriptional adapter 2-alpha
TADA2A
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YXZ4A0A0J9YXZ4_HUMAN
Transcriptional adapter 2-alpha
TADA2A
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WZS1A0A087WZS1_HUMAN
Transcriptional adapter 2-alpha
TADA2A
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YWZ4A0A0J9YWZ4_HUMAN
Transcriptional adapter 2-alpha
TADA2A
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti117H → Y in AAH01172 (PubMed:15489334).Curated1
Sequence conflicti153P → L in AAC39902 (PubMed:9674425).Curated1
Sequence conflicti185W → R in AAC26659 (Ref. 2) Curated1
Sequence conflicti304D → N in AAC26659 (Ref. 2) Curated1
Sequence conflicti342D → G in AAC26659 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0474666P → SCombined sources4 PublicationsCorresponds to variant dbSNP:rs7211875Ensembl.1
Natural variantiVAR_047467115M → V1 PublicationCorresponds to variant dbSNP:rs1054865Ensembl.1
Natural variantiVAR_047468351I → M. Corresponds to variant dbSNP:rs2522969Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_040347275 – 305LEFEL…RTYDH → CRWFLSLEQYLCVYIYINRR DNGVFYVKFYK in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_040348306 – 443Missing in isoform 2. 1 PublicationAdd BLAST138

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF064094 mRNA Translation: AAC26659.1
AK022767 mRNA Translation: BAG51111.1
AC004099 Genomic DNA No translation available.
AC068400 Genomic DNA No translation available.
AC068447 Genomic DNA No translation available.
BC001172 mRNA Translation: AAH01172.1
BC011753 mRNA Translation: AAH11753.1
AF069732 mRNA Translation: AAC39902.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11319.1 [O75478-1]
CCDS45656.1 [O75478-2]

NCBI Reference Sequences

More...RefSeqi		NP_001159577.2, NM_001166105.2
NP_001278847.1, NM_001291918.1
NP_001479.4, NM_001488.4
NP_597683.3, NM_133439.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000617828; ENSP00000482484; ENSG00000277104 [O75478-1]
ENST00000622522; ENSP00000481283; ENSG00000277104 [O75478-1]
ENST00000633468; ENSP00000488016; ENSG00000277104 [O75478-1]
ENST00000633584; ENSP00000487973; ENSG00000277104 [O75478-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6871

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6871

UCSC genome browser

More...UCSCi		uc032ghw.2 human [O75478-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064094 mRNA Translation: AAC26659.1
AK022767 mRNA Translation: BAG51111.1
AC004099 Genomic DNA No translation available.
AC068400 Genomic DNA No translation available.
AC068447 Genomic DNA No translation available.
BC001172 mRNA Translation: AAH01172.1
BC011753 mRNA Translation: AAH11753.1
AF069732 mRNA Translation: AAC39902.1
CCDSiCCDS11319.1 [O75478-1]
CCDS45656.1 [O75478-2]
RefSeqiNP_001159577.2, NM_001166105.2
NP_001278847.1, NM_001291918.1
NP_001479.4, NM_001488.4
NP_597683.3, NM_133439.3

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X41NMR-A72-116[»]
SMRiO75478
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi112734, 159 interactors
ComplexPortaliCPX-1004 PCAF-containing ATAC complex
CPX-989 PCAF histone acetylase complex
CPX-997 GCN5-containing ATAC complex
CORUMiO75478
DIPiDIP-28151N
IntActiO75478, 59 interactors
MINTiO75478
STRINGi9606.ENSP00000481091

PTM databases

iPTMnetiO75478
PhosphoSitePlusiO75478

Polymorphism and mutation databases

BioMutaiTADA2A

Proteomic databases

EPDiO75478
jPOSTiO75478
MassIVEiO75478
MaxQBiO75478
PaxDbiO75478
PeptideAtlasiO75478
PRIDEiO75478
ProteomicsDBi50040 [O75478-1]
50041 [O75478-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		6871

Genome annotation databases

EnsembliENST00000617828; ENSP00000482484; ENSG00000277104 [O75478-1]
ENST00000622522; ENSP00000481283; ENSG00000277104 [O75478-1]
ENST00000633468; ENSP00000488016; ENSG00000277104 [O75478-1]
ENST00000633584; ENSP00000487973; ENSG00000277104 [O75478-2]
GeneIDi6871
KEGGihsa:6871
UCSCiuc032ghw.2 human [O75478-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6871
DisGeNETi6871

GeneCards: human genes, protein and diseases

More...GeneCardsi		TADA2A
HGNCiHGNC:11531 TADA2A
MIMi602276 gene
neXtProtiNX_O75478
PharmGKBiPA36306

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0457 Eukaryota
COG5114 LUCA
InParanoidiO75478
KOiK11314
OrthoDBi812864at2759
PhylomeDBiO75478
TreeFamiTF313975

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TADA2A human
EvolutionaryTraceiO75478

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TADA2L

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6871
PharosiO75478 Tbio

Protein Ontology

More...PROi		PR:O75478
RNActiO75478 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Family and domain databases

CDDicd00167 SANT, 1 hit
cd02335 ZZ_ADA2, 1 hit
InterProiView protein in InterPro
IPR041983 ADA2-like_ZZ
IPR016827 Ada2/TADA2
IPR009057 Homeobox-like_sf
IPR001005 SANT/Myb
IPR017884 SANT_dom
IPR007526 SWIRM
PfamiView protein in Pfam
PF00249 Myb_DNA-binding, 1 hit
PF04433 SWIRM, 1 hit
PIRSFiPIRSF025024 Transcriptional_adaptor_2, 1 hit
SMARTiView protein in SMART
SM00717 SANT, 1 hit
SUPFAMiSSF46689 SSF46689, 2 hits
PROSITEiView protein in PROSITE
PS51293 SANT, 1 hit
PS50934 SWIRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTAD2A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75478
Secondary accession number(s): A8MVD0
, B3KMU9, Q9BVJ0, Q9UCW2, Q9UP49
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 11, 2011
Last modified: April 22, 2020
This is version 203 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again