TADA2A

Functionⁱ

Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity). Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling. May promote TP53/p53 'Lys-321' acetylation, leading to reduced TP53 stability and transcriptional activity (PubMed:22644376). May also promote XRCC6 acetylation thus facilitating cell apoptosis in response to DNA damage (PubMed:22644376).By similarity2 Publications

Regions

Feature key	Position(s)	DescriptionActions	Graphical view	Length
DNA bindingⁱ	426 – 435	By similarity		10

GO - Molecular functionⁱ

chromatin binding Source: GO_Central
DNA binding Source: UniProtKB-KW
DNA-binding transcription factor activity
Source: ProtInc
Traceable author statementⁱ
- 8552087
RNA polymerase II transcription factor activity, sequence-specific DNA binding Source: NTNU_SB
transcription coactivator activity Source: GO_Central
transcription coregulator activity
Source: ProtInc
Traceable author statementⁱ
- 8552087

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

chromatin remodeling Source: GO_Central
histone H3 acetylation
Source: UniProtKB
Inferred from direct assayⁱ
- 9674425
positive regulation of histone acetylation Source: GO_Central
regulation of transcription by RNA polymerase II Source: GO_Central
transcription by RNA polymerase II
Source: ProtInc
Traceable author statementⁱ
- 8552087

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	DNA-binding
Biological process	Transcription, Transcription regulation

Enzyme and pathway databases

Reactomeⁱ	R-HSA-3214847 HATs acetylate histones

Reactomeⁱ

R-HSA-3214847 HATs acetylate histones

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Transcriptional adapter 2-alpha Alternative name(s): Transcriptional adapter 2-like Short name: ADA2-like protein
Gene namesⁱ	Name:TADA2A Synonyms:TADA2L ORF Names:KL04P
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database More...HGNCⁱ	HGNC:11531 TADA2A
MIMⁱ	602276 gene
neXtProtⁱ	NX_O75478

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Chromosome, Nucleus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	6871
PharmGKBⁱ	PA36306

Polymorphism and mutation databases

BioMutaⁱ	TADA2A

BioMutaⁱ

TADA2A

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000197083	1 – 443	Transcriptional adapter 2-alphaAdd BLAST		443

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	6	Phosphoserine; in variant Ser-6Combined sources	1
Cross-linkⁱ	132	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linkⁱ	138	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMⁱ

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDⁱ	O75478
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	O75478
PaxDbⁱ	O75478
PeptideAtlas More...PeptideAtlasⁱ	O75478
PRIDEⁱ	O75478
ProteomicsDBⁱ	50040 50041 [O75478-2]

PTM databases

iPTMnetⁱ	O75478
PhosphoSitePlusⁱ	O75478

Expressionⁱ

Tissue specificityⁱ

Expressed in all tissues, but most abundantly in testis.

Gene expression databases

CleanExⁱ	HS_TADA2L

CleanExⁱ

HS_TADA2L

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA076497

HPAⁱ

HPA076497

Interactionⁱ

Subunit structureⁱ

Interacts with GCN5 and NR3C1. Associated with the P/CAF protein in the PCAF complex. Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, TAF6L/PAF65-alpha, TAF10/TAFII30, TAF12/TAFII20, TAF9/TAFII31 and TRRAP. Component of the ADA2A-containing complex (ATAC), composed of KAT14, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. Interacts with CCDC134 (PubMed:22644376).4 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
	Q5W150	3	EBI-742268,EBI-10248148
AATF	Q9NY61	4	EBI-742268,EBI-372428
C1orf109	Q9NX04	5	EBI-742268,EBI-8643161
CCDC134	Q9H6E4	6	EBI-742268,EBI-953766
CCHCR1	Q8TD31-3	3	EBI-742268,EBI-10175300
CDCA7L	Q96GN5	3	EBI-742268,EBI-5278764
EIF4E2	O60573	3	EBI-742268,EBI-398610
FANCG	A0A0S2Z3R2	3	EBI-742268,EBI-16438045
FANCG	A0A0S2Z4A7	3	EBI-742268,EBI-16433879
FARS2	O95363	3	EBI-742268,EBI-2513774
FBF1	Q8TES7-6	3	EBI-742268,EBI-10244131
GPSM3	Q9Y4H4	3	EBI-742268,EBI-347538
HGS	O14964	3	EBI-742268,EBI-740220
KLC4	Q9NSK0	3	EBI-742268,EBI-949319
KLHL38	Q2WGJ6	3	EBI-742268,EBI-6426443
KPNA2	P52292	3	EBI-742268,EBI-349938
MAGOH	P61326	3	EBI-742268,EBI-299134
MFAP1	P55081	3	EBI-742268,EBI-1048159
MTX2	O75431	3	EBI-742268,EBI-7415268
PPP1R16B	Q96T49	3	EBI-742268,EBI-10293968
PRPF31	Q8WWY3	3	EBI-742268,EBI-1567797
RNF6	A0A0S2Z4G9	3	EBI-742268,EBI-16428950
RTL8B	Q17RB0	3	EBI-742268,EBI-10238588
SF3A3	Q12874	3	EBI-742268,EBI-1051880
TEKT4	Q8WW24	3	EBI-742268,EBI-750487
TTC23	Q5W5X9	3	EBI-742268,EBI-6447954
TTC9C	Q8N5M4	3	EBI-742268,EBI-2851213
ZFYVE26	Q68DK2-5	3	EBI-742268,EBI-8656416
ZNF564	Q8TBZ8	3	EBI-742268,EBI-10273713
ZNF688	A0A0S2Z5X4	3	EBI-742268,EBI-16429014

Protein-protein interaction databases

BioGridⁱ	112734, 154 interactors
ComplexPortalⁱ	CPX-1004 PCAF-containing ATAC complex CPX-989 PCAF histone acetylase complex CPX-997 GCN5-containing ATAC complex
CORUMⁱ	O75478
Database of interacting proteins More...DIPⁱ	DIP-28151N
IntActⁱ	O75478, 52 interactors
Molecular INTeraction database More...MINTⁱ	O75478
STRINGⁱ	9606.ENSP00000225396

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	73 – 75	Combined sources	3
Helixⁱ	77 – 89	Combined sources	13
Helixⁱ	95 – 102	Combined sources	8
Helixⁱ	107 – 117	Combined sources	11

Show more details

3D structure databases

ProteinModelPortalⁱ	O75478
SMRⁱ	O75478
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	O75478

EvolutionaryTraceⁱ

O75478

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	70 – 122	SANTPROSITE-ProRule annotationAdd BLAST		53
Domainⁱ	356 – 443	SWIRMPROSITE-ProRule annotationAdd BLAST		88

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	17 – 45	Cys-richAdd BLAST		29

Phylogenomic databases

eggNOGⁱ	KOG0457 Eukaryota COG5114 LUCA
HOGENOMⁱ	HOG000068147
HOVERGENⁱ	HBG060876
InParanoidⁱ	O75478
KEGG Orthology (KO) More...KOⁱ	K11314
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G06WT
PhylomeDBⁱ	O75478
TreeFamⁱ	TF313975

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00167 SANT, 1 hit
InterProⁱ	View protein in InterPro IPR016827 Ada2/TADA2 IPR009057 Homeobox-like_sf IPR001005 SANT/Myb IPR017884 SANT_dom IPR007526 SWIRM
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00249 Myb_DNA-binding, 1 hit PF04433 SWIRM, 1 hit
PIRSFⁱ	PIRSF025024 Transcriptional_adaptor_2, 1 hit
SMARTⁱ	View protein in SMART SM00717 SANT, 1 hit
SUPFAMⁱ	SSF46689 SSF46689, 2 hits
PROSITEⁱ	View protein in PROSITE PS51293 SANT, 1 hit PS50934 SWIRM, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 9 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: O75478-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRLGPFSND PSDKPPCRGC SSYLMEPYIK CAECGPPPFF LCLQCFTRGF 
        60         70         80         90        100
EYKKHQSDHT YEIMTSDFPV LDPSWTAQEE MALLEAVMDC GFGNWQDVAN 
       110        120        130        140        150
QMCTKTKEEC EKHYMKHFIN NPLFASTLLN LKQAEEAKTA DTAIPFHSTD 
       160        170        180        190        200
DPPRPTFDSL LSRDMAGYMP ARADFIEEFD NYAEWDLRDI DFVEDDSDIL 
       210        220        230        240        250
HALKMAVVDI YHSRLKERQR RKKIIRDHGL INLRKFQLME RRYPKEVQDL 
       260        270        280        290        300
YETMRRFARI VGPVEHDKFI ESHALEFELR REIKRLQEYR TAGITNFCSA 
       310        320        330        340        350
RTYDHLKKTR EEERLKRTML SEVLQYIQDS SACQQWLRRQ ADIDSGLSPS 
       360        370        380        390        400
IPMASNSGRR SAPPLNLTGL PGTEKLNEKE KELCQMVRLV PGAYLEYKSA 
       410        420        430        440 
LLNECNKQGG LRLAQARALI KIDVNKTRKI YDFLIREGYI TKG

Length:443

Mass (Da):51,506

Last modified:January 11, 2011 - v3

Checksum:ⁱA4E1D87B1B3F6BA5

GO

Isoform 2 (identifier: O75478-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
275-305: LEFELRREIKRLQEYRTAGITNFCSARTYDH → CRWFLSLEQYLCVYIYINRRDNGVFYVKFYK
306-443: Missing.

« Hide

        10         20         30         40         50
MDRLGPFSND PSDKPPCRGC SSYLMEPYIK CAECGPPPFF LCLQCFTRGF 
        60         70         80         90        100
EYKKHQSDHT YEIMTSDFPV LDPSWTAQEE MALLEAVMDC GFGNWQDVAN 
       110        120        130        140        150
QMCTKTKEEC EKHYMKHFIN NPLFASTLLN LKQAEEAKTA DTAIPFHSTD 
       160        170        180        190        200
DPPRPTFDSL LSRDMAGYMP ARADFIEEFD NYAEWDLRDI DFVEDDSDIL 
       210        220        230        240        250
HALKMAVVDI YHSRLKERQR RKKIIRDHGL INLRKFQLME RRYPKEVQDL 
       260        270        280        290        300
YETMRRFARI VGPVEHDKFI ESHACRWFLS LEQYLCVYIY INRRDNGVFY 

VKFYK

Show »

Length:305

Mass (Da):36,054

Checksum:ⁱ51386043D3BB294C

GO

Computationally mapped potential isoform sequencesⁱ

There are 9 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A024R0Y4	A0A024R0Y4_HUMAN	Transcriptional adapter Transcriptional adapter	TADA2A TADA2L, hCG_28187	443	Annotation score:
A0A087WWR4	A0A087WWR4_HUMAN	Transcriptional adapter 2-alpha Transcriptional adapter 2-alpha (Transcriptional adaptor 2 (ADA2 homolog, yeast)-like, isoform CRA_c)	TADA2A TADA2L, hCG_28187	305	Annotation score:
A0A087WYK3	A0A087WYK3_HUMAN	Transcriptional adapter 2-alpha Transcriptional adapter 2-alpha	TADA2A	84	Annotation score:
A0A087X2C8	A0A087X2C8_HUMAN	Transcriptional adapter 2-alpha Transcriptional adapter 2-alpha	TADA2A	56	Annotation score:
A0A087WTV5	A0A087WTV5_HUMAN	Transcriptional adapter 2-alpha Transcriptional adapter 2-alpha	TADA2A	194	Annotation score:
A0A087WZS1	A0A087WZS1_HUMAN	Transcriptional adapter 2-alpha Transcriptional adapter 2-alpha	TADA2A	95	Annotation score:
A0A087WU71	A0A087WU71_HUMAN	Transcriptional adapter 2-alpha Transcriptional adapter 2-alpha	TADA2A	133	Annotation score:
A0A0J9YWZ4	A0A0J9YWZ4_HUMAN	Transcriptional adapter 2-alpha Transcriptional adapter 2-alpha	TADA2A	95	Annotation score:
A0A0J9YXZ4	A0A0J9YXZ4_HUMAN	Transcriptional adapter 2-alpha Transcriptional adapter 2-alpha	TADA2A	133	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	117	H → Y in AAH01172 (PubMed:15489334).Curated	1
Sequence conflictⁱ	153	P → L in AAC39902 (PubMed:9674425).Curated	1
Sequence conflictⁱ	185	W → R in AAC26659 (Ref. 2) Curated	1
Sequence conflictⁱ	304	D → N in AAC26659 (Ref. 2) Curated	1
Sequence conflictⁱ	342	D → G in AAC26659 (Ref. 2) Curated	1

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_047466	6	P → SCombined sources4 PublicationsCorresponds to variant dbSNP:rs7211875Ensembl.	1
Natural variantⁱVAR_047467	115	M → V1 PublicationCorresponds to variant dbSNP:rs1054865Ensembl.	1
Natural variantⁱVAR_047468	351	I → M. Corresponds to variant dbSNP:rs2522969Ensembl.	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_040347	275 – 305	LEFEL…RTYDH → CRWFLSLEQYLCVYIYINRR DNGVFYVKFYK in isoform 2. 1 PublicationAdd BLAST		31
Alternative sequenceⁱVSP_040348	306 – 443	Missing in isoform 2. 1 PublicationAdd BLAST		138

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF064094 mRNA Translation: AAC26659.1 AK022767 mRNA Translation: BAG51111.1 AC004099 Genomic DNA No translation available. AC068400 Genomic DNA No translation available. AC068447 Genomic DNA No translation available. BC001172 mRNA Translation: AAH01172.1 BC011753 mRNA Translation: AAH11753.1 AF069732 mRNA Translation: AAC39902.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS11319.1 [O75478-1] CCDS45656.1 [O75478-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_001159577.2, NM_001166105.2 NP_001278847.1, NM_001291918.1 NP_001479.4, NM_001488.4 NP_597683.3, NM_133439.3
UniGeneⁱ	Hs.500066 Hs.633101

Genome annotation databases

Ensemblⁱ	ENST00000617828; ENSP00000482484; ENSG00000277104 [O75478-1] ENST00000622522; ENSP00000481283; ENSG00000277104 [O75478-1] ENST00000633468; ENSP00000488016; ENSG00000277104 [O75478-1] ENST00000633584; ENSP00000487973; ENSG00000277104 [O75478-2]
GeneIDⁱ	6871
KEGGⁱ	hsa:6871
UCSC genome browser More...UCSCⁱ	uc032ghw.2 human [O75478-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Protein	Similar proteins		Species	Score	Length	Source
O75478	Transcriptional adaptor 2A isoform 1 (Fragment)		HUMAN		443	UniRef100_O75478
Transcriptional adapter 2-alpha		HUMAN		95
Transcriptional adaptor 2A isoform 2		HUMAN		147

Protein	Similar proteins		Species	Score	Length	Source
O75478	Transcriptional adapter 2-alpha		CHICK		446	UniRef90_O75478
Transcriptional adapter 2-alpha		RAT		443
Transcriptional adapter 2-alpha	)	MOUSE		443
Transcriptional adapter 2-alpha		BOVIN		443
Transcriptional adaptor 2A isoform 1 (Fragment)		HUMAN		443
+172
O75478-2	LOW QUALITY PROTEIN: transcriptional adaptor 2A		LEPWE		306	UniRef90_O75478-2
Transcriptional adapter 2-alpha		HUMAN		305
TADA2A isoform 7		PANTR		305
TADA2A isoform 9		PONAB		305
Uncharacterized protein		Cebus capucinus imitator		301
+2

Protein	Similar proteins		Species	Score	Length	Source
O75478	Transcriptional adapter 2-alpha		CHICK		446	UniRef50_O75478
Transcriptional adapter 2-alpha		BOVIN		443
Transcriptional adapter 2-alpha		RAT		443
Transcriptional adapter 2-alpha	)	MOUSE		443
Transcriptional adaptor 2A isoform 1 (Fragment)		HUMAN		443
+219
O75478-2	LOW QUALITY PROTEIN: transcriptional adaptor 2A		LEPWE		306	UniRef50_O75478-2
TADA2A isoform 9		PONAB		305
Transcriptional adapter 2-alpha		HUMAN		305
TADA2A isoform 7		PANTR		305
Uncharacterized protein		Cebus capucinus imitator		301
+5

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF064094 mRNA Translation: AAC26659.1 AK022767 mRNA Translation: BAG51111.1 AC004099 Genomic DNA No translation available. AC068400 Genomic DNA No translation available. AC068447 Genomic DNA No translation available. BC001172 mRNA Translation: AAH01172.1 BC011753 mRNA Translation: AAH11753.1 AF069732 mRNA Translation: AAC39902.1
CCDSⁱ	CCDS11319.1 [O75478-1] CCDS45656.1 [O75478-2]
RefSeqⁱ	NP_001159577.2, NM_001166105.2 NP_001278847.1, NM_001291918.1 NP_001479.4, NM_001488.4 NP_597683.3, NM_133439.3
UniGeneⁱ	Hs.500066 Hs.633101

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1X41	NMR	-	A	72-116	[»]
ProteinModelPortalⁱ	O75478
SMRⁱ	O75478
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	112734, 154 interactors
ComplexPortalⁱ	CPX-1004 PCAF-containing ATAC complex CPX-989 PCAF histone acetylase complex CPX-997 GCN5-containing ATAC complex
CORUMⁱ	O75478
DIPⁱ	DIP-28151N
IntActⁱ	O75478, 52 interactors
MINTⁱ	O75478
STRINGⁱ	9606.ENSP00000225396

PTM databases

iPTMnetⁱ	O75478
PhosphoSitePlusⁱ	O75478

Polymorphism and mutation databases

BioMutaⁱ	TADA2A

BioMutaⁱ

TADA2A

Proteomic databases

EPDⁱ	O75478
MaxQBⁱ	O75478
PaxDbⁱ	O75478
PeptideAtlasⁱ	O75478
PRIDEⁱ	O75478
ProteomicsDBⁱ	50040 50041 [O75478-2]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	6871
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000617828; ENSP00000482484; ENSG00000277104 [O75478-1] ENST00000622522; ENSP00000481283; ENSG00000277104 [O75478-1] ENST00000633468; ENSP00000488016; ENSG00000277104 [O75478-1] ENST00000633584; ENSP00000487973; ENSG00000277104 [O75478-2]
GeneIDⁱ	6871
KEGGⁱ	hsa:6871
UCSCⁱ	uc032ghw.2 human [O75478-1]

Organism-specific databases

CTDⁱ	6871
DisGeNETⁱ	6871
GeneCardsⁱ	TADA2A
H-InvDBⁱ	HIX0013744
HGNCⁱ	HGNC:11531 TADA2A
HPAⁱ	HPA076497
MIMⁱ	602276 gene
neXtProtⁱ	NX_O75478
PharmGKBⁱ	PA36306
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG0457 Eukaryota COG5114 LUCA
HOGENOMⁱ	HOG000068147
HOVERGENⁱ	HBG060876
InParanoidⁱ	O75478
KOⁱ	K11314
OrthoDBⁱ	EOG091G06WT
PhylomeDBⁱ	O75478
TreeFamⁱ	TF313975

Enzyme and pathway databases

Reactomeⁱ	R-HSA-3214847 HATs acetylate histones

Reactomeⁱ

R-HSA-3214847 HATs acetylate histones

Miscellaneous databases

ChiTaRSⁱ	TADA2A human
EvolutionaryTraceⁱ	O75478
GeneWikiⁱ	TADA2L
GenomeRNAiⁱ	6871
Protein Ontology More...PROⁱ	PR:O75478
SOURCEⁱ	Search...

Gene expression databases

CleanExⁱ	HS_TADA2L

CleanExⁱ

HS_TADA2L

Family and domain databases

CDDⁱ	cd00167 SANT, 1 hit
InterProⁱ	View protein in InterPro IPR016827 Ada2/TADA2 IPR009057 Homeobox-like_sf IPR001005 SANT/Myb IPR017884 SANT_dom IPR007526 SWIRM
Pfamⁱ	View protein in Pfam PF00249 Myb_DNA-binding, 1 hit PF04433 SWIRM, 1 hit
PIRSFⁱ	PIRSF025024 Transcriptional_adaptor_2, 1 hit
SMARTⁱ	View protein in SMART SM00717 SANT, 1 hit
SUPFAMⁱ	SSF46689 SSF46689, 2 hits
PROSITEⁱ	View protein in PROSITE PS51293 SANT, 1 hit PS50934 SWIRM, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	TAD2A_HUMAN
Accessionⁱ	O75478Primary (citable) accession number: O75478 Secondary accession number(s): A8MVD0 , B3KMU9, Q9BVJ0, Q9UCW2, Q9UP49
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	April 27, 2001
	Last sequence update:	January 11, 2011
	Last modified:	October 10, 2018
	This is version 190 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 17
Human chromosome 17: entries, gene names and cross-references to MIM
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O75478 (TAD2A_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Transcriptional adapter 2-alpha

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Compositional bias

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ