Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - O75469 (NR1I2_HUMAN)

Entry version 223 (29 Sep 2021)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Nuclear receptor subfamily 1 group I member 2

Gene

NR1I2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.

6 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei247Hyperforin; agonistCombined sources1 Publication1
Binding sitei407Hyperforin; agonistCombined sources1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi38 – 107Nuclear receptorPROSITE-ProRule annotationAdd BLAST70
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri41 – 61NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri77 – 102NR C4-typePROSITE-ProRule annotationAdd BLAST26

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O75469

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-383280, Nuclear Receptor transcription pathway
R-HSA-4090294, SUMOylation of intracellular receptors [O75469-1]

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O75469

SIGNOR Signaling Network Open Resource

More...SIGNORi		O75469

Protein family/group databases

Transport Classification Database

More...TCDBi		9.B.208.1.3, the vitamin d3 receptor (vdr) family

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001583

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear receptor subfamily 1 group I member 2
Alternative name(s):
Orphan nuclear receptor PAR1
Orphan nuclear receptor PXR
Pregnane X receptor
Steroid and xenobiotic receptor
Short name:
SXR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NR1I2
Synonyms:PXR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7968, NR1I2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603065, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75469

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000144852

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi66 – 67RR → AA: Abolishes nuclear localization; when associated with 91-A-A-92. 1 Publication2
Mutagenesisi91 – 92RR → AA: Abolishes nuclear localization; when associated with 66-A-A-67. 1 Publication2

Organism-specific databases

DisGeNET

More...DisGeNETi		8856

Open Targets

More...OpenTargetsi		ENSG00000144852

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA378

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75469, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3401

Drug and drug target database

More...DrugBanki		DB04468, Afimoxifene
DB14001, alpha-Tocopherol succinate
DB01393, Bezafibrate
DB00564, Carbamazepine
DB06777, Chenodeoxycholic acid
DB01068, Clonazepam
DB00257, Clotrimazole
DB00531, Cyclophosphamide
DB14002, D-alpha-Tocopherol acetate
DB01234, Dexamethasone
DB14649, Dexamethasone acetate
DB00255, Diethylstilbestrol
DB01248, Docetaxel
DB05928, Dovitinib
DB01127, Econazole
DB00530, Erlotinib
DB00783, Estradiol
DB13952, Estradiol acetate
DB13953, Estradiol benzoate
DB13954, Estradiol cypionate
DB13955, Estradiol dienanthate
DB13956, Estradiol valerate
DB00977, Ethinylestradiol
DB00754, Ethotoin
DB01039, Fenofibrate
DB13873, Fenofibric acid
DB00499, Flutamide
DB01645, Genistein
DB07931, Hexestrol
DB01892, Hyperforin
DB01181, Ifosfamide
DB01026, Ketoconazole
DB00431, Lindane
DB00532, Mephenytoin
DB00849, Methylphenobarbital
DB01110, Miconazole
DB00834, Mifepristone
DB11605, Myrrh
DB01115, Nifedipine
DB00239, Oxiconazole
DB01229, Paclitaxel
DB00312, Pentobarbital
DB04930, Permethrin
DB01174, Phenobarbital
DB04824, Phenolphthalein
DB00252, Phenytoin
DB12582, Piperine
DB01708, Prasterone
DB02789, Pregnenolone
DB11087, Pyrethrum extract
DB04216, Quercetin
DB02709, Resveratrol
DB01045, Rifampicin
DB01220, Rifaximin
DB08864, Rilpivirine
DB00503, Ritonavir
DB00421, Spironolactone
DB04466, SR12813
DB01138, Sulfinpyrazone
DB00675, Tamoxifen
DB07080, TO-901317
DB08604, Triclosan
DB13179, Troleandomycin
DB00163, Vitamin E
DB00682, Warfarin

DrugCentral

More...DrugCentrali		O75469

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		606

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NR1I2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000535471 – 434Nuclear receptor subfamily 1 group I member 2Add BLAST434

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75469

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75469

PeptideAtlas

More...PeptideAtlasi		O75469

PRoteomics IDEntifications database

More...PRIDEi		O75469

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		50027 [O75469-1]
50028 [O75469-2]
50029 [O75469-3]
50030 [O75469-4]
50031 [O75469-5]
50032 [O75469-6]
50033 [O75469-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75469

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75469

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in liver, colon and small intestine.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000144852, Expressed in right lobe of liver and 95 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75469, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75469, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000144852, Group enriched (blood, intestine, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with RXR.

Interacts with NCOA1.

Interacts (via domain NR LBD) with CRY1 and CRY2 in a ligand-dependent manner (By similarity).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114380, 42 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-496, RXRalpha-PXR nuclear receptor complex
CPX-517, PXR-NCOA1 activated nuclear receptor complex

Protein interaction database and analysis system

More...IntActi		O75469, 11 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000336528

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O75469

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75469, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1434
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O75469

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O75469

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini146 – 433NR LBDPROSITE-ProRule annotationAdd BLAST288

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni108 – 145HingeAdd BLAST38
Regioni285 – 288Hyperforin binding; agonistCombined sources1 Publication4

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi66 – 92Bipartite nuclear localization signalAdd BLAST27

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nuclear hormone receptor family. NR1 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri41 – 61NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri77 – 102NR C4-typePROSITE-ProRule annotationAdd BLAST26

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3575, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161118

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75469

Identification of Orthologs from Complete Genome Data

More...OMAi		GSIWNYK

Database of Orthologous Groups

More...OrthoDBi		297114at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75469

TreeFam database of animal gene trees

More...TreeFami		TF316304

Family and domain databases

Database of protein disorder

More...DisProti		DP00323

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.565.10, 1 hit
3.30.50.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00361

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00398, STRDHORMONER
PR00047, STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48508, SSF48508, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1A (identifier: O75469-1) [UniParc]FASTAAdd to basket
Also known as: 1, PRR1-A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVRPKESWN HADFVHCEDT ESVPGKPSVN ADEEVGGPQI CRVCGDKATG 
        60         70         80         90        100
YHFNVMTCEG CKGFFRRAMK RNARLRCPFR KGACEITRKT RRQCQACRLR 
       110        120        130        140        150
KCLESGMKKE MIMSDEAVEE RRALIKRKKS ERTGTQPLGV QGLTEEQRMM 
       160        170        180        190        200
IRELMDAQMK TFDTTFSHFK NFRLPGVLSS GCELPESLQA PSREEAAKWS 
       210        220        230        240        250
QVRKDLCSLK VSLQLRGEDG SVWNYKPPAD SGGKEIFSLL PHMADMSTYM 
       260        270        280        290        300
FKGIISFAKV ISYFRDLPIE DQISLLKGAA FELCQLRFNT VFNAETGTWE 
       310        320        330        340        350
CGRLSYCLED TAGGFQQLLL EPMLKFHYML KKLQLHEEEY VLMQAISLFS 
       360        370        380        390        400
PDRPGVLQHR VVDQLQEQFA ITLKSYIECN RPQPAHRFLF LKIMAMLTEL 
       410        420        430 
RSINAQHTQR LLRIQDIHPF ATPLMQELFG ITGS
Length:434
Mass (Da):49,762
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1DF6A2AE3109C4DA
GO
Isoform 1B (identifier: O75469-2) [UniParc]FASTAAdd to basket
Also known as: PRR1-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:379
Mass (Da):43,706
Checksum:i7B79CBF8A100C0F0
GO
Isoform 1C (identifier: O75469-3) [UniParc]FASTAAdd to basket
Also known as: PRR1-C

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPRGEVGAKNLPPNSPRGPEANL

Show »
Length:457
Mass (Da):52,129
Checksum:i37EFF759461EFE94
GO
Isoform 2A (identifier: O75469-4) [UniParc]FASTAAdd to basket
Also known as: 2, PRR2-A

The sequence of this isoform differs from the canonical sequence as follows:
     174-210: Missing.

Show »
Length:397
Mass (Da):45,766
Checksum:i5F0007EFD27260F9
GO
Isoform 2B (identifier: O75469-5) [UniParc]FASTAAdd to basket
Also known as: PRR2-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.
     174-210: Missing.

Show »
Length:342
Mass (Da):39,710
Checksum:i7D4EA16E5A132B0B
GO
Isoform 2C (identifier: O75469-6) [UniParc]FASTAAdd to basket
Also known as: PRR2-C

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDPRGEVGAKNLPPNSPRGPEANL
     174-210: Missing.

Show »
Length:420
Mass (Da):48,134
Checksum:iCE6179469491C1EF
GO
Isoform 3 (identifier: O75469-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTVTRTHHFKEGSLRAPAIPLHSAAAELASNHPRGPEANL

Show »
Length:473
Mass (Da):53,899
Checksum:i3049D23C9B903016
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KPQ3J3KPQ3_HUMAN
Nuclear receptor subfamily 1 group ...
NR1I2 hCG_21777
434Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8E2H0Y8E2_HUMAN
Nuclear receptor subfamily 1 group ...
NR1I2 hCG_21777
397Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti109K → N in CAB55489 (Ref. 5) Curated1
Sequence conflicti109K → N in CAB55490 (Ref. 5) Curated1
Sequence conflicti109K → N in CAB55491 (Ref. 5) Curated1
Sequence conflicti109K → N in CAB55492 (Ref. 5) Curated1
Sequence conflicti109K → N in CAB55493 (Ref. 5) Curated1
Sequence conflicti109K → N in CAB55494 (Ref. 5) Curated1
Sequence conflicti174Missing in AAH17304 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05058112A → T1 PublicationCorresponds to variant dbSNP:rs1063955Ensembl.1
Natural variantiVAR_03323718E → K1 PublicationCorresponds to variant dbSNP:rs59371185Ensembl.1
Natural variantiVAR_01222827P → S in allele PXR*2. 2 PublicationsCorresponds to variant dbSNP:rs12721613Ensembl.1
Natural variantiVAR_01222936G → R in allele PXR*3. 1 PublicationCorresponds to variant dbSNP:rs12721607Ensembl.1
Natural variantiVAR_01834098R → C1 PublicationCorresponds to variant dbSNP:rs72551371Ensembl.1
Natural variantiVAR_012230122R → Q in allele PXR*4. 1 PublicationCorresponds to variant dbSNP:rs12721608Ensembl.1
Natural variantiVAR_018341148R → Q1 PublicationCorresponds to variant dbSNP:rs72551373Ensembl.1
Natural variantiVAR_033238370A → T1 PublicationCorresponds to variant dbSNP:rs35761343Ensembl.1
Natural variantiVAR_018342381R → W1 PublicationCorresponds to variant dbSNP:rs72551375Ensembl.1
Natural variantiVAR_018343403I → V1 PublicationCorresponds to variant dbSNP:rs72551376Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0036681 – 55Missing in isoform 1B and isoform 2B. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0036671M → MDPRGEVGAKNLPPNSPRGP EANL in isoform 1C and isoform 2C. 1 Publication1
Alternative sequenceiVSP_0266691M → MTVTRTHHFKEGSLRAPAIP LHSAAAELASNHPRGPEANL in isoform 3. 1 Publication1
Alternative sequenceiVSP_003669174 – 210Missing in isoform 2A, isoform 2B and isoform 2C. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY091855 mRNA Translation: AAM26736.1
AF061056 mRNA Translation: AAD05436.1
AF084644 mRNA Translation: AAC64557.1
AF084645 mRNA Translation: AAC64558.1
AF364606 Genomic DNA Translation: AAK38720.1
AF364606 Genomic DNA Translation: AAK38721.1
AF364606 Genomic DNA Translation: AAK38722.1
AJ009936 mRNA Translation: CAB55489.1
AJ009936 mRNA Translation: CAB55490.1
AJ009936 mRNA Translation: CAB55491.1
AJ009937 mRNA Translation: CAB55492.1
AJ009937 mRNA Translation: CAB55493.1
AJ009937 mRNA Translation: CAB55494.1
DQ911122 Genomic DNA Translation: ABJ52965.1
DQ923326 Genomic DNA Translation: ABJ52966.1
EF614253 Genomic DNA Translation: ABR09276.1
BC017304 mRNA Translation: AAH17304.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2995.1 [O75469-7]
CCDS43136.1 [O75469-1]
CCDS54627.1 [O75469-4]

NCBI Reference Sequences

More...RefSeqi		NP_003880.3, NM_003889.3 [O75469-1]
NP_071285.1, NM_022002.2 [O75469-7]
NP_148934.1, NM_033013.2 [O75469-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000337940; ENSP00000336528; ENSG00000144852 [O75469-7]
ENST00000393716; ENSP00000377319; ENSG00000144852 [O75469-1]
ENST00000466380; ENSP00000420297; ENSG00000144852 [O75469-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8856

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8856

UCSC genome browser

More...UCSCi		uc003edk.3, human [O75469-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY091855 mRNA Translation: AAM26736.1
AF061056 mRNA Translation: AAD05436.1
AF084644 mRNA Translation: AAC64557.1
AF084645 mRNA Translation: AAC64558.1
AF364606 Genomic DNA Translation: AAK38720.1
AF364606 Genomic DNA Translation: AAK38721.1
AF364606 Genomic DNA Translation: AAK38722.1
AJ009936 mRNA Translation: CAB55489.1
AJ009936 mRNA Translation: CAB55490.1
AJ009936 mRNA Translation: CAB55491.1
AJ009937 mRNA Translation: CAB55492.1
AJ009937 mRNA Translation: CAB55493.1
AJ009937 mRNA Translation: CAB55494.1
DQ911122 Genomic DNA Translation: ABJ52965.1
DQ923326 Genomic DNA Translation: ABJ52966.1
EF614253 Genomic DNA Translation: ABR09276.1
BC017304 mRNA Translation: AAH17304.2
CCDSiCCDS2995.1 [O75469-7]
CCDS43136.1 [O75469-1]
CCDS54627.1 [O75469-4]
RefSeqiNP_003880.3, NM_003889.3 [O75469-1]
NP_071285.1, NM_022002.2 [O75469-7]
NP_148934.1, NM_033013.2 [O75469-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ILGX-ray2.52A130-434[»]
1ILHX-ray2.76A130-434[»]
1M13X-ray2.15A130-434[»]
1NRLX-ray2.00A/B130-434[»]
1SKXX-ray2.80A130-431[»]
2O9IX-ray2.80A/B142-434[»]
2QNVX-ray2.80A130-434[»]
3CTBX-ray2.00A/B130-434[»]
3HVLX-ray2.10A/B130-434[»]
3R8DX-ray2.80A130-434[»]
4J5WX-ray2.80A/B130-434[»]
4J5XX-ray2.80A/B130-434[»]
4NY9X-ray2.80A142-431[»]
4S0SX-ray2.80A/B130-434[»]
4S0TX-ray3.14A/B130-434[»]
4X1FX-ray2.00A130-434[»]
4X1GX-ray2.25A130-434[»]
4XAOX-ray2.58A130-434[»]
4XHDX-ray2.40A130-434[»]
5A86X-ray2.25A/B130-432[»]
5X0RX-ray2.67A/B130-434[»]
6BNSX-ray2.56A/B130-434[»]
6DUPX-ray2.30A/B130-426[»]
6HJ2X-ray2.28A130-434[»]
6HTYX-ray2.22A/B129-434[»]
6NX1X-ray2.27A/B130-434[»]
6P2BX-ray2.30A/B130-434[»]
6S41X-ray2.70A/B138-434[»]
6TFIX-ray1.85A/B129-434[»]
6XP9X-ray2.27A/B130-434[»]
7AX8X-ray2.15A130-434[»]
7AX9X-ray2.25A130-434[»]
7AXAX-ray2.26A130-434[»]
7AXBX-ray2.55A130-434[»]
7AXCX-ray2.05A130-434[»]
7AXDX-ray2.65A130-434[»]
7AXEX-ray1.90A130-434[»]
7AXFX-ray2.45A130-434[»]
7AXGX-ray2.70A130-434[»]
7AXHX-ray2.55A130-434[»]
7AXIX-ray2.15A130-434[»]
7AXJX-ray2.30A130-434[»]
7AXKX-ray2.00A130-434[»]
7AXLX-ray2.50A130-434[»]
SMRiO75469
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi114380, 42 interactors
ComplexPortaliCPX-496, RXRalpha-PXR nuclear receptor complex
CPX-517, PXR-NCOA1 activated nuclear receptor complex
IntActiO75469, 11 interactors
STRINGi9606.ENSP00000336528

Chemistry databases

BindingDBiO75469
ChEMBLiCHEMBL3401
DrugBankiDB04468, Afimoxifene
DB14001, alpha-Tocopherol succinate
DB01393, Bezafibrate
DB00564, Carbamazepine
DB06777, Chenodeoxycholic acid
DB01068, Clonazepam
DB00257, Clotrimazole
DB00531, Cyclophosphamide
DB14002, D-alpha-Tocopherol acetate
DB01234, Dexamethasone
DB14649, Dexamethasone acetate
DB00255, Diethylstilbestrol
DB01248, Docetaxel
DB05928, Dovitinib
DB01127, Econazole
DB00530, Erlotinib
DB00783, Estradiol
DB13952, Estradiol acetate
DB13953, Estradiol benzoate
DB13954, Estradiol cypionate
DB13955, Estradiol dienanthate
DB13956, Estradiol valerate
DB00977, Ethinylestradiol
DB00754, Ethotoin
DB01039, Fenofibrate
DB13873, Fenofibric acid
DB00499, Flutamide
DB01645, Genistein
DB07931, Hexestrol
DB01892, Hyperforin
DB01181, Ifosfamide
DB01026, Ketoconazole
DB00431, Lindane
DB00532, Mephenytoin
DB00849, Methylphenobarbital
DB01110, Miconazole
DB00834, Mifepristone
DB11605, Myrrh
DB01115, Nifedipine
DB00239, Oxiconazole
DB01229, Paclitaxel
DB00312, Pentobarbital
DB04930, Permethrin
DB01174, Phenobarbital
DB04824, Phenolphthalein
DB00252, Phenytoin
DB12582, Piperine
DB01708, Prasterone
DB02789, Pregnenolone
DB11087, Pyrethrum extract
DB04216, Quercetin
DB02709, Resveratrol
DB01045, Rifampicin
DB01220, Rifaximin
DB08864, Rilpivirine
DB00503, Ritonavir
DB00421, Spironolactone
DB04466, SR12813
DB01138, Sulfinpyrazone
DB00675, Tamoxifen
DB07080, TO-901317
DB08604, Triclosan
DB13179, Troleandomycin
DB00163, Vitamin E
DB00682, Warfarin
DrugCentraliO75469
GuidetoPHARMACOLOGYi606
SwissLipidsiSLP:000001583

Protein family/group databases

TCDBi9.B.208.1.3, the vitamin d3 receptor (vdr) family

PTM databases

iPTMnetiO75469
PhosphoSitePlusiO75469

Genetic variation databases

BioMutaiNR1I2

Proteomic databases

MassIVEiO75469
PaxDbiO75469
PeptideAtlasiO75469
PRIDEiO75469
ProteomicsDBi50027 [O75469-1]
50028 [O75469-2]
50029 [O75469-3]
50030 [O75469-4]
50031 [O75469-5]
50032 [O75469-6]
50033 [O75469-7]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		16619, 417 antibodies

The DNASU plasmid repository

More...DNASUi		8856

Genome annotation databases

EnsembliENST00000337940; ENSP00000336528; ENSG00000144852 [O75469-7]
ENST00000393716; ENSP00000377319; ENSG00000144852 [O75469-1]
ENST00000466380; ENSP00000420297; ENSG00000144852 [O75469-4]
GeneIDi8856
KEGGihsa:8856
UCSCiuc003edk.3, human [O75469-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8856
DisGeNETi8856

GeneCards: human genes, protein and diseases

More...GeneCardsi		NR1I2
HGNCiHGNC:7968, NR1I2
HPAiENSG00000144852, Group enriched (blood, intestine, liver)
MIMi603065, gene
neXtProtiNX_O75469
OpenTargetsiENSG00000144852
PharmGKBiPA378
VEuPathDBiHostDB:ENSG00000144852

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3575, Eukaryota
GeneTreeiENSGT00940000161118
InParanoidiO75469
OMAiGSIWNYK
OrthoDBi297114at2759
PhylomeDBiO75469
TreeFamiTF316304

Enzyme and pathway databases

PathwayCommonsiO75469
ReactomeiR-HSA-383280, Nuclear Receptor transcription pathway
R-HSA-4090294, SUMOylation of intracellular receptors [O75469-1]
SignaLinkiO75469
SIGNORiO75469

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8856, 2 hits in 1032 CRISPR screens
EvolutionaryTraceiO75469

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Pregnane_X_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8856
PharosiO75469, Tchem

Protein Ontology

More...PROi		PR:O75469
RNActiO75469, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000144852, Expressed in right lobe of liver and 95 other tissues
ExpressionAtlasiO75469, baseline and differential
GenevisibleiO75469, HS

Family and domain databases

DisProtiDP00323
Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
IDEALiIID00361
InterProiView protein in InterPro
IPR035500, NHR-like_dom_sf
IPR000536, Nucl_hrmn_rcpt_lig-bd
IPR001723, Nuclear_hrmn_rcpt
IPR001628, Znf_hrmn_rcpt
IPR013088, Znf_NHR/GATA
PfamiView protein in Pfam
PF00104, Hormone_recep, 1 hit
PF00105, zf-C4, 1 hit
PRINTSiPR00398, STRDHORMONER
PR00047, STROIDFINGER
SMARTiView protein in SMART
SM00430, HOLI, 1 hit
SM00399, ZnF_C4, 1 hit
SUPFAMiSSF48508, SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843, NR_LBD, 1 hit
PS00031, NUCLEAR_REC_DBD_1, 1 hit
PS51030, NUCLEAR_REC_DBD_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNR1I2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75469
Secondary accession number(s): Q006P5
, Q008C8, Q96AC7, Q9UJ22, Q9UJ23, Q9UJ24, Q9UJ25, Q9UJ26, Q9UJ27, Q9UNW4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: September 29, 2021
This is version 223 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again