E2F6

Functionⁱ

Inhibitor of E2F-dependent transcription. Binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3'. Has a preference for the 5'-TTTCCCGC-3' E2F recognition site. E2F6 lacks the transcriptional activation and pocket protein binding domains. Appears to regulate a subset of E2F-dependent genes whose products are required for entry into the cell cycle but not for normal cell cycle progression. May silence expression via the recruitment of a chromatin remodeling complex containing histone H3-K9 methyltransferase activity. Overexpression delays the exit of cells from the S-phase.

Regions

Feature key	Position(s)	DescriptionActions	Graphical view	Length
DNA bindingⁱ	50 – 129	Sequence analysisAdd BLAST		80

GO - Molecular functionⁱ

DNA binding
Source: ProtInc
Traceable author statementⁱ
- 9501179
DNA-binding transcription factor activity, RNA polymerase II-specific Source: NTNU_SB
protein dimerization activity Source: InterPro
proximal promoter DNA-binding transcription activator activity, RNA polymerase II-specific
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
proximal promoter DNA-binding transcription repressor activity, RNA polymerase II-specific
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
sequence-specific DNA binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
transcription corepressor activity
Source: ProtInc
Traceable author statementⁱ
- 9501179
transcription factor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

negative regulation of G0 to G1 transition Source: Reactome
negative regulation of transcription by RNA polymerase II
Source: NTNU_SB
Inferred from direct assayⁱ
- 9501179
positive regulation of transcription by RNA polymerase II
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
regulation of cell cycle
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
regulation of transcription involved in G1/S transition of mitotic cell cycle Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	DNA-binding, Repressor
Biological process	Cell cycle, Transcription, Transcription regulation

Enzyme and pathway databases

Reactomeⁱ	R-HSA-539107 Activation of E2F1 target genes at G1/S R-HSA-8953750 Transcriptional Regulation by E2F6
SignaLinkⁱ	O75461

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Transcription factor E2F6 Short name: E2F-6
Gene namesⁱ	Name:E2F6
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000169016.16
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:3120 E2F6
MIMⁱ	602944 gene
neXtProtⁱ	NX_O75461

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	68	L → E: Reduction in repressor activity, little effect on S-phase entry.		1

Organism-specific databases

DisGeNET More...DisGeNETⁱ	1876
Open Targets More...OpenTargetsⁱ	ENSG00000169016
PharmGKBⁱ	PA27578

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000219472	1 – 281	Transcription factor E2F6Add BLAST		281

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Cross-linkⁱ	9	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMⁱ

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDⁱ	O75461
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	O75461
PaxDbⁱ	O75461
PeptideAtlas More...PeptideAtlasⁱ	O75461
PRIDEⁱ	O75461
ProteomicsDBⁱ	50023 50024 [O75461-2]

PTM databases

iPTMnetⁱ	O75461
PhosphoSitePlusⁱ	O75461

Expressionⁱ

Tissue specificityⁱ

Expressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen.

Gene expression databases

Bgeeⁱ	ENSG00000169016 Expressed in 94 organ(s), highest expression level in gastrocnemius
CleanExⁱ	HS_E2F6
ExpressionAtlasⁱ	O75461 baseline and differential
Genevisibleⁱ	O75461 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA075185

HPAⁱ

HPA075185

Interactionⁱ

Subunit structureⁱ

Component of the DRTF1/E2F transcription factor complex. Forms heterodimers with DP family members. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10.2 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
KRTAP10-7	P60409	3	EBI-749694,EBI-10172290
MAX	P61244	4	EBI-749694,EBI-751711
TFDP1	Q14186	15	EBI-749694,EBI-749713
TFDP2	Q14188	8	EBI-749694,EBI-752268
TFDP2	Q14188-5	7	EBI-749694,EBI-12181237

GO - Molecular functionⁱ

protein dimerization activity Source: InterPro
transcription factor binding
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	108208, 49 interactors
CORUMⁱ	O75461
Database of interacting proteins More...DIPⁱ	DIP-41699N
IntActⁱ	O75461, 50 interactors
Molecular INTeraction database More...MINTⁱ	O75461
STRINGⁱ	9606.ENSP00000370936

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	O75461
SMRⁱ	O75461
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Length
Regionⁱ	130 – 222	DimerizationSequence analysisAdd BLAST	93
Regionⁱ	143 – 164	Leucine-zipperAdd BLAST	22
Regionⁱ	173 – 281	Transcription repressionAdd BLAST	109

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	95 – 129	DEF boxAdd BLAST		35

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	265 – 268	Poly-Glu		4

Sequence similaritiesⁱ

Belongs to the E2F/DP family.Curated

Phylogenomic databases

eggNOGⁱ	KOG2577 Eukaryota ENOG410XNYI LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00550000074403
HOGENOMⁱ	HOG000112309
HOVERGENⁱ	HBG002227
InParanoidⁱ	O75461
KEGG Orthology (KO) More...KOⁱ	K09390
OMAⁱ	DPINVES
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G087U
PhylomeDBⁱ	O75461
TreeFamⁱ	TF105566

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd14660 E2F_DD, 1 hit
Gene3Dⁱ	1.10.10.10, 1 hit
InterProⁱ	View protein in InterPro IPR015633 E2F IPR037241 E2F-DP_heterodim IPR032198 E2F_CC-MB IPR003316 E2F_WHTH_DNA-bd_dom IPR015635 Transcription_factor_E2F6 IPR036388 WH-like_DNA-bd_sf IPR036390 WH_DNA-bd_sf
PANTHERⁱ	PTHR12081 PTHR12081, 1 hit PTHR12081:SF19 PTHR12081:SF19, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF16421 E2F_CC-MB, 1 hit PF02319 E2F_TDP, 1 hit
SMARTⁱ	View protein in SMART SM01372 E2F_TDP, 1 hit
SUPFAMⁱ	SSF144074 SSF144074, 1 hit SSF46785 SSF46785, 1 hit

Sequences (3+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 3 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: O75461-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQQRPARKL PSLLLDPTEE TVRRRCRDPI NVEGLLPSKI RINLEDNVQY 
        60         70         80         90        100
VSMRKALKVK RPRFDVSLVY LTRKFMDLVR SAPGGILDLN KVATKLGVRK 
       110        120        130        140        150
RRVYDITNVL DGIDLVEKKS KNHIRWIGSD LSNFGAVPQQ KKLQEELSDL 
       160        170        180        190        200
SAMEDALDEL IKDCAQQLFE LTDDKENERL AYVTYQDIHS IQAFHEQIVI 
       210        220        230        240        250
AVKAPAETRL DVPAPREDSI TVHIRSTNGP IDVYLCEVEQ GQTSNKRSEG 
       260        270        280 
VGTSSSESTH PEGPEEEENP QQSEELLEVS N

Length:281

Mass (Da):31,844

Last modified:November 1, 1998 - v1

Checksum:ⁱ539E049C15AD3508

GO

Isoform 2 (identifier: O75461-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-75: Missing.

« Hide

        10         20         30         40         50
MDLVRSAPGG ILDLNKVATK LGVRKRRVYD ITNVLDGIDL VEKKSKNHIR 
        60         70         80         90        100
WIGSDLSNFG AVPQQKKLQE ELSDLSAMED ALDELIKDCA QQLFELTDDK 
       110        120        130        140        150
ENERLAYVTY QDIHSIQAFH EQIVIAVKAP AETRLDVPAP REDSITVHIR 
       160        170        180        190        200
STNGPIDVYL CEVEQGQTSN KRSEGVGTSS SESTHPEGPE EEENPQQSEE 

LLEVSN

Show »

Length:206

Mass (Da):22,982

Checksum:ⁱ6C79669AFD6F42EC

GO

Isoform 3 (identifier: O75461-3) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-36: MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLL → MNPS

« Hide

        10         20         30         40         50
MNPSPSKIRI NLEDNVQYVS MRKALKVKRP RFDVSLVYLT RKFMDLVRSA 
        60         70         80         90        100
PGGILDLNKV ATKLGVRKRR VYDITNVLDG IDLVEKKSKN HIRWIGSDLS 
       110        120        130        140        150
NFGAVPQQKK LQEELSDLSA MEDALDELIK DCAQQLFELT DDKENERLAY 
       160        170        180        190        200
VTYQDIHSIQ AFHEQIVIAV KAPAETRLDV PAPREDSITV HIRSTNGPID 
       210        220        230        240 
VYLCEVEQGQ TSNKRSEGVG TSSSESTHPE GPEEEENPQQ SEELLEVSN

Show »

Length:249

Mass (Da):28,103

Checksum:ⁱ49DE2FD637490D32

GO

Computationally mapped potential isoform sequencesⁱ

There are 4 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

Q2Z196	Q2Z196_HUMAN	E2F transcription factor 6 isoform ... E2F transcription factor 6 isoform 3 (Putative truncated transcription factor E2F6) (Transcription factor E2F6)	E2F6	38	Annotation score:
Q2Z197	Q2Z197_HUMAN	Putative truncated transcription fa... Putative truncated transcription factor E2F6 (Transcription factor E2F6)	E2F6	50	Annotation score:
F8WEZ5	F8WEZ5_HUMAN	Transcription factor E2F6 Transcription factor E2F6	E2F6	63	Annotation score:
F8WC40	F8WC40_HUMAN	Transcription factor E2F6 Transcription factor E2F6	E2F6	55	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	7 – 8	AR → HE in AAC14694 (PubMed:9501179).Curated	2
Sequence conflictⁱ	66	V → A in AAT02637 (PubMed:15081404).Curated	1
Sequence conflictⁱ	220	I → V in AAC14694 (PubMed:9501179).Curated	1
Sequence conflictⁱ	229	G → E in AAC14694 (PubMed:9501179).Curated	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_008771	1 – 75	Missing in isoform 2. 1 PublicationAdd BLAST		75
Alternative sequenceⁱVSP_054754	1 – 36	MSQQR…VEGLL → MNPS in isoform 3. 1 PublicationAdd BLAST		36

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF059292 mRNA Translation: AAC31426.1 AY083996 mRNA Translation: AAM10783.1 AY083997 Genomic DNA Translation: AAM10784.1 AY083997 Genomic DNA Translation: AAM10785.1 AY551347 mRNA Translation: AAT02637.1 AJ493061 Genomic DNA Translation: CAD37950.1 AK290413 mRNA Translation: BAF83102.1 AC099344 Genomic DNA Translation: AAY14826.1 CH471053 Genomic DNA Translation: EAX00931.1 BC008348 mRNA Translation: AAH08348.1 BC107740 mRNA Translation: AAI07741.1 AF041381 mRNA Translation: AAC14694.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS1680.2 [O75461-1] CCDS62858.1 [O75461-2] CCDS62859.1 [O75461-3]
NCBI Reference Sequences More...RefSeqⁱ	NP_001265204.1, NM_001278275.1 [O75461-3] NP_001265205.1, NM_001278276.1 [O75461-2] NP_001265206.1, NM_001278277.1 [O75461-2] NP_001265207.1, NM_001278278.1 [O75461-2] NP_937987.2, NM_198256.3 [O75461-1]
UniGeneⁱ	Hs.603093

Genome annotation databases

Ensemblⁱ	ENST00000307236; ENSP00000302159; ENSG00000169016 [O75461-3] ENST00000381525; ENSP00000370936; ENSG00000169016 [O75461-1] ENST00000542100; ENSP00000446315; ENSG00000169016 [O75461-2] ENST00000546212; ENSP00000438864; ENSG00000169016 [O75461-2]
GeneIDⁱ	1876
KEGGⁱ	hsa:1876
UCSC genome browser More...UCSCⁱ	uc002rbf.4 human [O75461-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O75461	E2F transcription factor 6 isoform 1 (Fragment)		HUMAN		281	UniRef100_O75461
E2F transcription factor 6		PANTR		281
E2F6 isoform 3		PONAB		281
Uncharacterized protein		PANPA		281
E2F transcription factor 6, isoform CRA_d		HUMAN		206
+5
O75461-3	E2F transcription factor 6		PANTR		249	UniRef100_A0A2I3TJZ7
E2F6 isoform 5		PONAB		249
Uncharacterized protein		PANPA		249

Protein	Similar proteins		Species	Score	Length	Source
O75461	E2F transcription factor 6 isoform 1 (Fragment)		HUMAN		281	UniRef90_O75461
E2F transcription factor 6		PANTR		281
E2F6 isoform 3		PONAB		281
Uncharacterized protein		PANPA		281
E2F transcription factor 6		CALJA		283
+78
O75461-3	Transcription factor E2F6		BOVIN		285	UniRef90_Q08DY6
transcription factor E2F6 isoform X1		TURTR		295
transcription factor E2F6		Florida manatee		289
transcription factor E2F6 isoform X5		PHYCD		287
Uncharacterized protein		MUSPF		282
+79

Protein	Similar proteins		Species	Score	Length	Source
O75461	Transcription factor E2F6		MOUSE		272	UniRef50_O75461
E2F transcription factor 6 isoform 1 (Fragment)		HUMAN		281
E2F transcription factor 6		PANTR		281
E2F6 isoform 3		PONAB		281
Uncharacterized protein		PANPA		281
+113
O75461-3	Transcription factor E2F6		BOVIN		285	UniRef50_Q08DY6
transcription factor E2F6 isoform X1		TURTR		295
transcription factor E2F6		Florida manatee		289
transcription factor E2F6 isoform X5		PHYCD		287
Uncharacterized protein		FELCA		282
+90

Cross-referencesⁱ

Web resourcesⁱ

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF059292 mRNA Translation: AAC31426.1 AY083996 mRNA Translation: AAM10783.1 AY083997 Genomic DNA Translation: AAM10784.1 AY083997 Genomic DNA Translation: AAM10785.1 AY551347 mRNA Translation: AAT02637.1 AJ493061 Genomic DNA Translation: CAD37950.1 AK290413 mRNA Translation: BAF83102.1 AC099344 Genomic DNA Translation: AAY14826.1 CH471053 Genomic DNA Translation: EAX00931.1 BC008348 mRNA Translation: AAH08348.1 BC107740 mRNA Translation: AAI07741.1 AF041381 mRNA Translation: AAC14694.1
CCDSⁱ	CCDS1680.2 [O75461-1] CCDS62858.1 [O75461-2] CCDS62859.1 [O75461-3]
RefSeqⁱ	NP_001265204.1, NM_001278275.1 [O75461-3] NP_001265205.1, NM_001278276.1 [O75461-2] NP_001265206.1, NM_001278277.1 [O75461-2] NP_001265207.1, NM_001278278.1 [O75461-2] NP_937987.2, NM_198256.3 [O75461-1]
UniGeneⁱ	Hs.603093

3D structure databases

ProteinModelPortalⁱ	O75461
SMRⁱ	O75461
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	108208, 49 interactors
CORUMⁱ	O75461
DIPⁱ	DIP-41699N
IntActⁱ	O75461, 50 interactors
MINTⁱ	O75461
STRINGⁱ	9606.ENSP00000370936

PTM databases

iPTMnetⁱ	O75461
PhosphoSitePlusⁱ	O75461

Proteomic databases

EPDⁱ	O75461
MaxQBⁱ	O75461
PaxDbⁱ	O75461
PeptideAtlasⁱ	O75461
PRIDEⁱ	O75461
ProteomicsDBⁱ	50023 50024 [O75461-2]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	1876
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000307236; ENSP00000302159; ENSG00000169016 [O75461-3] ENST00000381525; ENSP00000370936; ENSG00000169016 [O75461-1] ENST00000542100; ENSP00000446315; ENSG00000169016 [O75461-2] ENST00000546212; ENSP00000438864; ENSG00000169016 [O75461-2]
GeneIDⁱ	1876
KEGGⁱ	hsa:1876
UCSCⁱ	uc002rbf.4 human [O75461-1]

Organism-specific databases

CTDⁱ	1876
DisGeNETⁱ	1876
EuPathDBⁱ	HostDB:ENSG00000169016.16
GeneCardsⁱ	E2F6
H-InvDBⁱ	HIX0060106
HGNCⁱ	HGNC:3120 E2F6
HPAⁱ	HPA075185
MIMⁱ	602944 gene
neXtProtⁱ	NX_O75461
OpenTargetsⁱ	ENSG00000169016
PharmGKBⁱ	PA27578
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2577 Eukaryota ENOG410XNYI LUCA
GeneTreeⁱ	ENSGT00550000074403
HOGENOMⁱ	HOG000112309
HOVERGENⁱ	HBG002227
InParanoidⁱ	O75461
KOⁱ	K09390
OMAⁱ	DPINVES
OrthoDBⁱ	EOG091G087U
PhylomeDBⁱ	O75461
TreeFamⁱ	TF105566

Enzyme and pathway databases

Reactomeⁱ	R-HSA-539107 Activation of E2F1 target genes at G1/S R-HSA-8953750 Transcriptional Regulation by E2F6
SignaLinkⁱ	O75461

Miscellaneous databases

ChiTaRSⁱ	E2F6 human
GenomeRNAiⁱ	1876
Protein Ontology More...PROⁱ	PR:O75461
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000169016 Expressed in 94 organ(s), highest expression level in gastrocnemius
CleanExⁱ	HS_E2F6
ExpressionAtlasⁱ	O75461 baseline and differential
Genevisibleⁱ	O75461 HS

Family and domain databases

CDDⁱ	cd14660 E2F_DD, 1 hit
Gene3Dⁱ	1.10.10.10, 1 hit
InterProⁱ	View protein in InterPro IPR015633 E2F IPR037241 E2F-DP_heterodim IPR032198 E2F_CC-MB IPR003316 E2F_WHTH_DNA-bd_dom IPR015635 Transcription_factor_E2F6 IPR036388 WH-like_DNA-bd_sf IPR036390 WH_DNA-bd_sf
PANTHERⁱ	PTHR12081 PTHR12081, 1 hit PTHR12081:SF19 PTHR12081:SF19, 1 hit
Pfamⁱ	View protein in Pfam PF16421 E2F_CC-MB, 1 hit PF02319 E2F_TDP, 1 hit
SMARTⁱ	View protein in SMART SM01372 E2F_TDP, 1 hit
SUPFAMⁱ	SSF144074 SSF144074, 1 hit SSF46785 SSF46785, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	E2F6_HUMAN
Accessionⁱ	O75461Primary (citable) accession number: O75461 Secondary accession number(s): A8K2Z8 , G5E936, O60544, Q53QY9, Q6Q9Z6, Q7Z2H6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 30, 2000
	Last sequence update:	November 1, 1998
	Last modified:	November 7, 2018
	This is version 171 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O75461 (E2F6_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Transcription factor E2F6

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Motif

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ