Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O75461 (E2F6_HUMAN)

Entry version 187 (07 Apr 2021)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Transcription factor E2F6

Gene

E2F6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibitor of E2F-dependent transcription (PubMed:9689056, PubMed:9704927, PubMed:9501179). Binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' (PubMed:9501179). Has a preference for the 5'-TTTCCCGC-3' E2F recognition site (PubMed:9501179). E2F6 lacks the transcriptional activation and pocket protein binding domains (PubMed:9704927, PubMed:9501179). Appears to regulate a subset of E2F-dependent genes whose products are required for entry into the cell cycle but not for normal cell cycle progression (PubMed:9689056, PubMed:9501179). Represses expression of some meiosis-specific genes, including SLC25A31/ANT4 (By similarity). May silence expression via the recruitment of a chromatin remodeling complex containing histone H3-K9 methyltransferase activity. Overexpression delays the exit of cells from the S-phase (PubMed:9501179).By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi50 – 129Sequence analysisAdd BLAST80

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processCell cycle, Transcription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O75461

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-69205, G1/S-Specific Transcription
R-HSA-8953750, Transcriptional Regulation by E2F6

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O75461

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor E2F6Curated
Short name:
E2F-61 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:E2F61 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:3120, E2F6

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602944, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75461

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000169016.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi68L → E: Reduction in repressor activity, little effect on S-phase entry. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		1876

Open Targets

More...OpenTargetsi		ENSG00000169016

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27578

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75461, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		E2F6

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002194721 – 281Transcription factor E2F6Add BLAST281

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki9Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O75461

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O75461

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75461

MaxQB - The MaxQuant DataBase

More...MaxQBi		O75461

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75461

PeptideAtlas

More...PeptideAtlasi		O75461

PRoteomics IDEntifications database

More...PRIDEi		O75461

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		33817
50023 [O75461-1]
50024 [O75461-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75461

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75461

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000169016, Expressed in gastrocnemius and 116 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75461, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75461, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000169016, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms heterodimers with DP family members TFDP1 or TFDP2 (PubMed:9704927).

Component of the DRTF1/E2F transcription factor complex (PubMed:12004135). Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2 (PubMed:12004135).

Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10 (PubMed:15960975).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		108208, 96 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O75461

Database of interacting proteins

More...DIPi		DIP-41699N

Protein interaction database and analysis system

More...IntActi		O75461, 55 interactors

Molecular INTeraction database

More...MINTi		O75461

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000370936

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75461, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O75461

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni130 – 222DimerizationSequence analysisAdd BLAST93
Regioni143 – 164Leucine-zipperAdd BLAST22
Regioni173 – 281Transcription repressionAdd BLAST109

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi95 – 129DEF boxAdd BLAST35

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi265 – 268Poly-Glu4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the E2F/DP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2577, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155734

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_032091_4_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75461

Identification of Orthologs from Complete Genome Data

More...OMAi		VEQNHSN

Database of Orthologous Groups

More...OrthoDBi		1087250at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75461

TreeFam database of animal gene trees

More...TreeFami		TF105566

Family and domain databases

Conserved Domains Database

More...CDDi		cd14660, E2F_DD, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR015633, E2F
IPR037241, E2F-DP_heterodim
IPR032198, E2F_CC-MB
IPR003316, E2F_WHTH_DNA-bd_dom
IPR015635, Transcription_factor_E2F6
IPR036388, WH-like_DNA-bd_sf
IPR036390, WH_DNA-bd_sf

The PANTHER Classification System

More...PANTHERi		PTHR12081, PTHR12081, 1 hit
PTHR12081:SF19, PTHR12081:SF19, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF16421, E2F_CC-MB, 1 hit
PF02319, E2F_TDP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01372, E2F_TDP, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF144074, SSF144074, 1 hit
SSF46785, SSF46785, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75461-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQQRPARKL PSLLLDPTEE TVRRRCRDPI NVEGLLPSKI RINLEDNVQY 
        60         70         80         90        100
VSMRKALKVK RPRFDVSLVY LTRKFMDLVR SAPGGILDLN KVATKLGVRK 
       110        120        130        140        150
RRVYDITNVL DGIDLVEKKS KNHIRWIGSD LSNFGAVPQQ KKLQEELSDL 
       160        170        180        190        200
SAMEDALDEL IKDCAQQLFE LTDDKENERL AYVTYQDIHS IQAFHEQIVI 
       210        220        230        240        250
AVKAPAETRL DVPAPREDSI TVHIRSTNGP IDVYLCEVEQ GQTSNKRSEG 
       260        270        280 
VGTSSSESTH PEGPEEEENP QQSEELLEVS N
Length:281
Mass (Da):31,844
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i539E049C15AD3508
GO
Isoform 2 (identifier: O75461-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: Missing.

Show »
Length:206
Mass (Da):22,982
Checksum:i6C79669AFD6F42EC
GO
Isoform 3 (identifier: O75461-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLL → MNPS

Show »
Length:249
Mass (Da):28,103
Checksum:i49DE2FD637490D32
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WEZ5F8WEZ5_HUMAN
Transcription factor E2F6
E2F6
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q2Z197Q2Z197_HUMAN
Putative truncated transcription fa...
E2F6
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC40F8WC40_HUMAN
Transcription factor E2F6
E2F6
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q2Z196Q2Z196_HUMAN
E2F transcription factor 6 isoform ...
E2F6
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti7 – 8AR → HE in AAC14694 (PubMed:9501179).Curated2
Sequence conflicti66V → A in AAT02637 (PubMed:15081404).Curated1
Sequence conflicti220I → V in AAC14694 (PubMed:9501179).Curated1
Sequence conflicti229G → E in AAC14694 (PubMed:9501179).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0087711 – 75Missing in isoform 2. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_0547541 – 36MSQQR…VEGLL → MNPS in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF059292 mRNA Translation: AAC31426.1
AY083996 mRNA Translation: AAM10783.1
AY083997 Genomic DNA Translation: AAM10784.1
AY083997 Genomic DNA Translation: AAM10785.1
AY551347 mRNA Translation: AAT02637.1
AJ493061 Genomic DNA Translation: CAD37950.1
AK290413 mRNA Translation: BAF83102.1
AC099344 Genomic DNA Translation: AAY14826.1
CH471053 Genomic DNA Translation: EAX00931.1
BC008348 mRNA Translation: AAH08348.1
BC107740 mRNA Translation: AAI07741.1
AF041381 mRNA Translation: AAC14694.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1680.2 [O75461-1]
CCDS62858.1 [O75461-2]
CCDS62859.1 [O75461-3]

NCBI Reference Sequences

More...RefSeqi		NP_001265204.1, NM_001278275.1 [O75461-3]
NP_001265205.1, NM_001278276.1 [O75461-2]
NP_001265206.1, NM_001278277.1 [O75461-2]
NP_001265207.1, NM_001278278.1 [O75461-2]
NP_937987.2, NM_198256.3 [O75461-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000307236; ENSP00000302159; ENSG00000169016 [O75461-3]
ENST00000381525; ENSP00000370936; ENSG00000169016 [O75461-1]
ENST00000542100; ENSP00000446315; ENSG00000169016 [O75461-2]
ENST00000546212; ENSP00000438864; ENSG00000169016 [O75461-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1876

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1876

UCSC genome browser

More...UCSCi		uc002rbf.4, human [O75461-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059292 mRNA Translation: AAC31426.1
AY083996 mRNA Translation: AAM10783.1
AY083997 Genomic DNA Translation: AAM10784.1
AY083997 Genomic DNA Translation: AAM10785.1
AY551347 mRNA Translation: AAT02637.1
AJ493061 Genomic DNA Translation: CAD37950.1
AK290413 mRNA Translation: BAF83102.1
AC099344 Genomic DNA Translation: AAY14826.1
CH471053 Genomic DNA Translation: EAX00931.1
BC008348 mRNA Translation: AAH08348.1
BC107740 mRNA Translation: AAI07741.1
AF041381 mRNA Translation: AAC14694.1
CCDSiCCDS1680.2 [O75461-1]
CCDS62858.1 [O75461-2]
CCDS62859.1 [O75461-3]
RefSeqiNP_001265204.1, NM_001278275.1 [O75461-3]
NP_001265205.1, NM_001278276.1 [O75461-2]
NP_001265206.1, NM_001278277.1 [O75461-2]
NP_001265207.1, NM_001278278.1 [O75461-2]
NP_937987.2, NM_198256.3 [O75461-1]

3D structure databases

SMRiO75461
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi108208, 96 interactors
CORUMiO75461
DIPiDIP-41699N
IntActiO75461, 55 interactors
MINTiO75461
STRINGi9606.ENSP00000370936

PTM databases

iPTMnetiO75461
PhosphoSitePlusiO75461

Genetic variation databases

BioMutaiE2F6

Proteomic databases

EPDiO75461
jPOSTiO75461
MassIVEiO75461
MaxQBiO75461
PaxDbiO75461
PeptideAtlasiO75461
PRIDEiO75461
ProteomicsDBi33817
50023 [O75461-1]
50024 [O75461-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		12671, 323 antibodies

The DNASU plasmid repository

More...DNASUi		1876

Genome annotation databases

EnsembliENST00000307236; ENSP00000302159; ENSG00000169016 [O75461-3]
ENST00000381525; ENSP00000370936; ENSG00000169016 [O75461-1]
ENST00000542100; ENSP00000446315; ENSG00000169016 [O75461-2]
ENST00000546212; ENSP00000438864; ENSG00000169016 [O75461-2]
GeneIDi1876
KEGGihsa:1876
UCSCiuc002rbf.4, human [O75461-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1876
DisGeNETi1876

GeneCards: human genes, protein and diseases

More...GeneCardsi		E2F6
HGNCiHGNC:3120, E2F6
HPAiENSG00000169016, Low tissue specificity
MIMi602944, gene
neXtProtiNX_O75461
OpenTargetsiENSG00000169016
PharmGKBiPA27578
VEuPathDBiHostDB:ENSG00000169016.16

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2577, Eukaryota
GeneTreeiENSGT00940000155734
HOGENOMiCLU_032091_4_0_1
InParanoidiO75461
OMAiVEQNHSN
OrthoDBi1087250at2759
PhylomeDBiO75461
TreeFamiTF105566

Enzyme and pathway databases

PathwayCommonsiO75461
ReactomeiR-HSA-69205, G1/S-Specific Transcription
R-HSA-8953750, Transcriptional Regulation by E2F6
SignaLinkiO75461

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		1876, 173 hits in 1019 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1876
PharosiO75461, Tbio

Protein Ontology

More...PROi		PR:O75461
RNActiO75461, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000169016, Expressed in gastrocnemius and 116 other tissues
ExpressionAtlasiO75461, baseline and differential
GenevisibleiO75461, HS

Family and domain databases

CDDicd14660, E2F_DD, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR015633, E2F
IPR037241, E2F-DP_heterodim
IPR032198, E2F_CC-MB
IPR003316, E2F_WHTH_DNA-bd_dom
IPR015635, Transcription_factor_E2F6
IPR036388, WH-like_DNA-bd_sf
IPR036390, WH_DNA-bd_sf
PANTHERiPTHR12081, PTHR12081, 1 hit
PTHR12081:SF19, PTHR12081:SF19, 1 hit
PfamiView protein in Pfam
PF16421, E2F_CC-MB, 1 hit
PF02319, E2F_TDP, 1 hit
SMARTiView protein in SMART
SM01372, E2F_TDP, 1 hit
SUPFAMiSSF144074, SSF144074, 1 hit
SSF46785, SSF46785, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiE2F6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75461
Secondary accession number(s): A8K2Z8
, G5E936, O60544, Q53QY9, Q6Q9Z6, Q7Z2H6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: April 7, 2021
This is version 187 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again