MAF

Functionⁱ

Acts as a transcriptional activator or repressor. Involved in embryonic lens fiber cell development. Recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. Activates the expression of IL4 in T helper 2 (Th2) cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression. Together with PAX6, transactivates strongly the glucagon gene promoter through the G1 element. Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction. Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. Binds to the sequence 5'-[GT]G[GC]N[GT]NCTCAGNN-3' in the L7 promoter. Binds to the T-MARE (Maf response element) sites of lens-specific alpha- and beta-crystallin gene promoters. Binds element G1 on the glucagon promoter. Binds an AT-rich region adjacent to the TGC motif (atypical Maf response element) in the CD13 proximal promoter in endothelial cells (By similarity). When overexpressed, represses anti-oxidant response element (ARE)-mediated transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds to the ARE sites of detoxifying enzyme gene promoters.By similarity5 Publications

GO - Molecular functionⁱ

RNA polymerase II transcription factor activity, sequence-specific DNA binding Source: NTNU_SB
sequence-specific DNA binding Source: Ensembl
transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding Source: Ensembl

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell development Source: Ensembl
cytokine production Source: Ensembl
inner ear development Source: Ensembl
lens fiber cell differentiation Source: GO_Central
negative regulation of transcription by RNA polymerase II Source: Ensembl
regulation of chondrocyte differentiation Source: Ensembl
transcription by RNA polymerase II
Source: ProtInc
Traceable author statementⁱ
- 9616139

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Activator, DNA-binding, Repressor
Biological process	Transcription, Transcription regulation

Enzyme and pathway databases

Reactomeⁱ	R-HSA-8940973 RUNX2 regulates osteoblast differentiation
SignaLinkⁱ	O75444
SIGNORⁱ	O75444

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Transcription factor Maf Alternative name(s): Proto-oncogene c-Maf V-maf musculoaponeurotic fibrosarcoma oncogene homolog
Gene namesⁱ	Name:MAF
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 16

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000178573.6
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:6776 MAF
MIMⁱ	177075 gene
neXtProtⁱ	NX_O75444

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Involvement in diseaseⁱ

A chromosomal aberration involving MAF is found in some forms of multiple myeloma (MM). Translocation t(14;16)(q32.3;q23) with an IgH locus.

Cataract 21, multiple types (CTRCT21)3 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn opacification of the crystalline lens of the eye that frequently results in visual impairment or blindness. Opacities vary in morphology, are often confined to a portion of the lens, and may be static or progressive. In general, the more posteriorly located and dense an opacity, the greater the impact on visual function. CTRCT21 includes cerulean and pulverulent cataracts. Cerulean cataracts are characterized by peripheral bluish and white opacifications organized in concentric layers with occasional central lesions arranged radially. The opacities are observed in the superficial layers of the fetal nucleus as well as the adult nucleus of the lens. Involvement is usually bilateral. Visual acuity is only mildly reduced in childhood. In adulthood, the opacifications may progress, making lens extraction necessary. Histologically the lesions are described as fusiform cavities between lens fibers which contain a deeply staining granular material. Although the lesions may take on various colors, a dull blue is the most common appearance and is responsible for the designation cerulean cataract. Pulverulent cataracts are characterized by a dust-like, 'pulverised' appearance of the opacities which can be found in any part of the lens. In some cases cataract is associated with microcornea without any other systemic anomaly or dysmorphism. Microcornea is defined by a corneal diameter inferior to 10 mm in both meridians in an otherwise normal eye.

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_029369	288	R → P in CTRCT21. 1 PublicationCorresponds to variant dbSNP:rs121917735EnsemblClinVar.	1
Natural variantⁱVAR_029370	297	K → R in CTRCT21. 1 PublicationCorresponds to variant dbSNP:rs121917736EnsemblClinVar.	1
Natural variantⁱVAR_073898	303	Q → L in CTRCT21. 1 Publication	1

Ayme-Gripp syndrome (AYGRP)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA multisystem disorder characterized by congenital cataracts, sensorineural deafness, intellectual disability, seizures, brachycephaly, distinctive flat facial appearance, skeletal anomalies, mammary gland hypoplasia, and reduced growth.

Keywords - Diseaseⁱ

Cataract, Disease mutation, Dwarfism, Mental retardation, Proto-oncogene, Tumor suppressor

Organism-specific databases

DisGeNET More...DisGeNETⁱ	4094
MalaCards human disease database More...MalaCardsⁱ	MAF
MIMⁱ	601088 phenotype 610202 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000178573
Orphanetⁱ	1377 Cataract-microcornea syndrome 98989 Cerulean cataract 98984 Pulverulent cataract
PharmGKBⁱ	PA30534

Polymorphism and mutation databases

BioMutaⁱ	MAF

BioMutaⁱ

MAF

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000076491	1 – 373	Transcription factor MafAdd BLAST		373

Amino acid modifications

Feature key	Position(s)	DescriptionActions
Cross-linkⁱ	29	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linkⁱ	33	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linkⁱ	331	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 1 (identifier: O75444-1)
Cross-linkⁱ	379	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Post-translational modificationⁱ

Keywords - PTMⁱ

Isopeptide bond, Ubl conjugation

Proteomic databases

PaxDbⁱ	O75444
PeptideAtlas More...PeptideAtlasⁱ	O75444
PRIDEⁱ	O75444
ProteomicsDBⁱ	50009 50010 [O75444-1]

PTM databases

iPTMnetⁱ	O75444
PhosphoSitePlusⁱ	O75444

Expressionⁱ

Tissue specificityⁱ

Expressed in endothelial cells.1 Publication

Inductionⁱ

Up-regulated with tert-butyl hydroquinone (t-BHQ).1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000178573 Expressed in 240 organ(s), highest expression level in jejunal mucosa
CleanExⁱ	HS_MAF
ExpressionAtlasⁱ	O75444 baseline and differential
Genevisibleⁱ	O75444 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB010296 HPA028289

HPAⁱ

CAB010296
HPA028289

Interactionⁱ

Subunit structureⁱ

Homodimer or heterodimer with other bHLH-Zip transcription factors. Binds DNA as a homodimer or as a heterodimer. Heterotetramer of two MAF and two USF2. Interacts with PAX6; the interaction is direct. Interacts with MYB; interaction takes place weakly in normal T-cells and increases in T-cells following stimulation through the TCR engagement. Interacts with MYB; the ternary complex formed with MYB and the CD13 promoter is regulated in response to differentiating signals. Interacts with USF2; the interaction inhibits its DNA-binding activity on the L7 promoter. Interacts with CREBBP, EP300 and ETS1 (By similarity).By similarity

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
BACH1	O14867	2	EBI-2805091,EBI-1263541
HBZ	P0C746	2	EBI-2805091,EBI-10890294	From Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A).
MAFB	Q9Y5Q3	2	EBI-2805091,EBI-3649340

Protein-protein interaction databases

BioGridⁱ	110269, 23 interactors
ELMⁱ	O75444
IntActⁱ	O75444, 6 interactors
STRINGⁱ	9606.ENSP00000327048

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	O75444
SMRⁱ	O75444
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	288 – 351	bZIPPROSITE-ProRule annotationAdd BLAST		64

Region

Feature key	Position(s)	DescriptionActions	Length
Regionⁱ	126 – 373	Represses ARE-mediated transcriptionAdd BLAST	248
Regionⁱ	288 – 313	Basic motifPROSITE-ProRule annotationAdd BLAST	26
Regionⁱ	316 – 337	Leucine-zipperPROSITE-ProRule annotationAdd BLAST	22

Compositional bias

Feature key	Position(s)	DescriptionActions	Length
Compositional biasⁱ	126 – 254	Gly-richAdd BLAST	129
Compositional biasⁱ	132 – 252	Ala-richAdd BLAST	121
Compositional biasⁱ	180 – 194	His-richAdd BLAST	15

Sequence similaritiesⁱ

Belongs to the bZIP family. Maf subfamily.Curated

Phylogenomic databases

eggNOGⁱ	KOG4196 Eukaryota ENOG410YCYQ LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00550000074549
HOGENOMⁱ	HOG000261683
HOVERGENⁱ	HBG000313
InParanoidⁱ	O75444
KEGG Orthology (KO) More...KOⁱ	K09035
OMAⁱ	GTVHPHM
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0H46
PhylomeDBⁱ	O75444
TreeFamⁱ	TF325689

Family and domain databases

InterProⁱ	View protein in InterPro IPR004827 bZIP IPR004826 bZIP_Maf IPR028573 Maf/V-MAF IPR013592 Maf_TF_N IPR008917 TF_DNA-bd_sf IPR024874 Transciption_factor_Maf_fam
PANTHERⁱ	PTHR10129 PTHR10129, 1 hit PTHR10129:SF9 PTHR10129:SF9, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF03131 bZIP_Maf, 1 hit PF08383 Maf_N, 1 hit
SMARTⁱ	View protein in SMART SM00338 BRLZ, 1 hit
SUPFAMⁱ	SSF47454 SSF47454, 1 hit
PROSITEⁱ	View protein in PROSITE PS50217 BZIP, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show all Align All

Isoform 2 (identifier: O75444-2) [UniParc]FASTA Add to basket

Also known as: Short

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASELAMSNS DLPTSPLAME YVNDFDLMKF EVKKEPVETD RIISQCGRLI 
        60         70         80         90        100
AGGSLSSTPM STPCSSVPPS PSFSAPSPGS GSEQKAHLED YYWMTGYPQQ 
       110        120        130        140        150
LNPEALGFSP EDAVEALISN SHQLQGGFDG YARGAQQLAA AAGAGAGASL 
       160        170        180        190        200
GGSGEEMGPA AAVVSAVIAA AAAQSGAGPH YHHHHHHAAG HHHHPTAGAP 
       210        220        230        240        250
GAAGSAAASA GGAGGAGGGG PASAGGGGGG GGGGGGGGAA GAGGALHPHH 
       260        270        280        290        300
AAGGLHFDDR FSDEQLVTMS VRELNRQLRG VSKEEVIRLK QKRRTLKNRG 
       310        320        330        340        350
YAQSCRFKRV QQRHVLESEK NQLLQQVDHL KQEISRLVRE RDAYKEKYEK 
       360        370 
LVSSGFRENG SSSDNPSSPE FFM

Length:373

Mass (Da):38,492

Last modified:February 10, 2009 - v2

Checksum:ⁱ566C2BC3E4A62762

GO

Isoform 1 (identifier: O75444-1) [UniParc]FASTA Add to basket

Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
373-373: M → ITEPTRKLEPSVGYATFWKPQHRVLTSVFTK

« Hide

        10         20         30         40         50
MASELAMSNS DLPTSPLAME YVNDFDLMKF EVKKEPVETD RIISQCGRLI 
        60         70         80         90        100
AGGSLSSTPM STPCSSVPPS PSFSAPSPGS GSEQKAHLED YYWMTGYPQQ 
       110        120        130        140        150
LNPEALGFSP EDAVEALISN SHQLQGGFDG YARGAQQLAA AAGAGAGASL 
       160        170        180        190        200
GGSGEEMGPA AAVVSAVIAA AAAQSGAGPH YHHHHHHAAG HHHHPTAGAP 
       210        220        230        240        250
GAAGSAAASA GGAGGAGGGG PASAGGGGGG GGGGGGGGAA GAGGALHPHH 
       260        270        280        290        300
AAGGLHFDDR FSDEQLVTMS VRELNRQLRG VSKEEVIRLK QKRRTLKNRG 
       310        320        330        340        350
YAQSCRFKRV QQRHVLESEK NQLLQQVDHL KQEISRLVRE RDAYKEKYEK 
       360        370        380        390        400
LVSSGFRENG SSSDNPSSPE FFITEPTRKL EPSVGYATFW KPQHRVLTSV 

FTK

Show »

Length:403

Mass (Da):41,961

Checksum:ⁱ263D2FF2AF8DFB5B

GO

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	H3BP11	H3BP11_HUMAN		Transcription factor Maf Transcription factor Maf	MAF	383	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_073891	54	S → L in AYGRP. 1 PublicationCorresponds to variant dbSNP:rs727502766EnsemblClinVar.	1
Natural variantⁱVAR_073892	58	T → A in AYGRP. 1 PublicationCorresponds to variant dbSNP:rs727502767EnsemblClinVar.	1
Natural variantⁱVAR_073893	58	T → I in AYGRP. 1 PublicationCorresponds to variant dbSNP:rs727502769EnsemblClinVar.	1
Natural variantⁱVAR_073894	59	P → H in AYGRP. 1 PublicationCorresponds to variant dbSNP:rs727502770EnsemblClinVar.	1
Natural variantⁱVAR_073895	59	P → L in AYGRP. 1 PublicationCorresponds to variant dbSNP:rs727502770EnsemblClinVar.	1
Natural variantⁱVAR_073896	62	T → R in AYGRP. 1 PublicationCorresponds to variant dbSNP:rs727502771EnsemblClinVar.	1
Natural variantⁱVAR_073897	69	P → R in AYGRP. 1 PublicationCorresponds to variant dbSNP:rs727502768EnsemblClinVar.	1
Natural variantⁱVAR_029369	288	R → P in CTRCT21. 1 PublicationCorresponds to variant dbSNP:rs121917735EnsemblClinVar.	1
Natural variantⁱVAR_029370	297	K → R in CTRCT21. 1 PublicationCorresponds to variant dbSNP:rs121917736EnsemblClinVar.	1
Natural variantⁱVAR_073898	303	Q → L in CTRCT21. 1 Publication	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_000583	373	M → ITEPTRKLEPSVGYATFWKP QHRVLTSVFTK in isoform 1. 1 Publication		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF055376 mRNA Translation: AAC27037.1 AF055377 mRNA Translation: AAC27038.1 AF055378 Genomic DNA Translation: AAC27039.1 AC009159 Genomic DNA No translation available. BC081542 mRNA Translation: AAH81542.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS10928.1 [O75444-1] CCDS42198.1 [O75444-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_001026974.1, NM_001031804.2 [O75444-2] NP_005351.2, NM_005360.4 [O75444-1]
UniGeneⁱ	Hs.134859

Genome annotation databases

Ensemblⁱ	ENST00000326043; ENSP00000327048; ENSG00000178573 [O75444-1] ENST00000393350; ENSP00000377019; ENSG00000178573 [O75444-2]
GeneIDⁱ	4094
KEGGⁱ	hsa:4094
UCSC genome browser More...UCSCⁱ	uc002ffm.4 human [O75444-2]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Chromosomal rearrangement

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O75444	Transcription factor Maf		HUMAN		383	UniRef100_O75444
MAF isoform 1		PANTR		383
MAF isoform 3		PANTR		373
O75444-1	MAF isoform 2		PANTR		403	UniRef100_A0A2J8LEB5

Protein	Similar proteins		Species	Score	Length	Source
O75444	Transcription factor Maf		MOUSE		370	UniRef90_P54843
Transcription factor Maf		BOVIN		377
Transcription factor Maf		RAT		369
transcription factor Maf isoform X1		PHYCD		432
Transcription factor Maf (Fragment)		NEOVI		71
+62

Protein	Similar proteins		Species	Score	Length	Source
O75444	Transcription factor Maf		MOUSE		370	UniRef50_P54843
Transcription factor Maf		BOVIN		377
Transcription factor Maf		RAT		369
Transcription factor Maf		XENTR		352
Transcription factor Maf		CHICK		359
+168

Cross-referencesⁱ

Web resourcesⁱ

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF055376 mRNA Translation: AAC27037.1 AF055377 mRNA Translation: AAC27038.1 AF055378 Genomic DNA Translation: AAC27039.1 AC009159 Genomic DNA No translation available. BC081542 mRNA Translation: AAH81542.1
CCDSⁱ	CCDS10928.1 [O75444-1] CCDS42198.1 [O75444-2]
RefSeqⁱ	NP_001026974.1, NM_001031804.2 [O75444-2] NP_005351.2, NM_005360.4 [O75444-1]
UniGeneⁱ	Hs.134859

3D structure databases

ProteinModelPortalⁱ	O75444
SMRⁱ	O75444
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	110269, 23 interactors
ELMⁱ	O75444
IntActⁱ	O75444, 6 interactors
STRINGⁱ	9606.ENSP00000327048

PTM databases

iPTMnetⁱ	O75444
PhosphoSitePlusⁱ	O75444

Polymorphism and mutation databases

BioMutaⁱ	MAF

BioMutaⁱ

MAF

Proteomic databases

PaxDbⁱ	O75444
PeptideAtlasⁱ	O75444
PRIDEⁱ	O75444
ProteomicsDBⁱ	50009 50010 [O75444-1]

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000326043; ENSP00000327048; ENSG00000178573 [O75444-1] ENST00000393350; ENSP00000377019; ENSG00000178573 [O75444-2]
GeneIDⁱ	4094
KEGGⁱ	hsa:4094
UCSCⁱ	uc002ffm.4 human [O75444-2]

Organism-specific databases

CTDⁱ	4094
DisGeNETⁱ	4094
EuPathDBⁱ	HostDB:ENSG00000178573.6
GeneCardsⁱ	MAF
H-InvDBⁱ	HIX0173268
HGNCⁱ	HGNC:6776 MAF
HPAⁱ	CAB010296 HPA028289
MalaCardsⁱ	MAF
MIMⁱ	177075 gene 601088 phenotype 610202 phenotype
neXtProtⁱ	NX_O75444
OpenTargetsⁱ	ENSG00000178573
Orphanetⁱ	1377 Cataract-microcornea syndrome 98989 Cerulean cataract 98984 Pulverulent cataract
PharmGKBⁱ	PA30534
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG4196 Eukaryota ENOG410YCYQ LUCA
GeneTreeⁱ	ENSGT00550000074549
HOGENOMⁱ	HOG000261683
HOVERGENⁱ	HBG000313
InParanoidⁱ	O75444
KOⁱ	K09035
OMAⁱ	GTVHPHM
OrthoDBⁱ	EOG091G0H46
PhylomeDBⁱ	O75444
TreeFamⁱ	TF325689

Enzyme and pathway databases

Reactomeⁱ	R-HSA-8940973 RUNX2 regulates osteoblast differentiation
SignaLinkⁱ	O75444
SIGNORⁱ	O75444

Miscellaneous databases

ChiTaRSⁱ	MAF human
GeneWikiⁱ	MAF_(gene)
GenomeRNAiⁱ	4094
Protein Ontology More...PROⁱ	PR:O75444
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000178573 Expressed in 240 organ(s), highest expression level in jejunal mucosa
CleanExⁱ	HS_MAF
ExpressionAtlasⁱ	O75444 baseline and differential
Genevisibleⁱ	O75444 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR004827 bZIP IPR004826 bZIP_Maf IPR028573 Maf/V-MAF IPR013592 Maf_TF_N IPR008917 TF_DNA-bd_sf IPR024874 Transciption_factor_Maf_fam
PANTHERⁱ	PTHR10129 PTHR10129, 1 hit PTHR10129:SF9 PTHR10129:SF9, 1 hit
Pfamⁱ	View protein in Pfam PF03131 bZIP_Maf, 1 hit PF08383 Maf_N, 1 hit
SMARTⁱ	View protein in SMART SM00338 BRLZ, 1 hit
SUPFAMⁱ	SSF47454 SSF47454, 1 hit
PROSITEⁱ	View protein in PROSITE PS50217 BZIP, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	MAF_HUMAN
Accessionⁱ	O75444Primary (citable) accession number: O75444 Secondary accession number(s): Q66I47, Q9UP93
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 11, 2002
	Last sequence update:	February 10, 2009
	Last modified:	September 12, 2018
	This is version 160 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 16
Human chromosome 16: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O75444 (MAF_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Transcription factor Maf

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ