Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

Gene

NDUFB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • NADH dehydrogenase (ubiquinone) activity Source: ProtInc

GO - Biological processi

  • mitochondrial electron transport, NADH to ubiquinone Source: UniProtKB
  • mitochondrial respiratory chain complex I assembly Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processElectron transport, Respiratory chain, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-611105 Respiratory electron transport
R-HSA-6799198 Complex I biogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Alternative name(s):
Complex I-MNLL
Short name:
CI-MNLL
NADH-ubiquinone oxidoreductase MNLL subunit
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NDUFB1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000183648.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7695 NDUFB1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603837 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75438

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei11 – 27HelicalSequence analysisAdd BLAST17

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000183648

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31501

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2363065

Drug and drug target database

More...
DrugBanki
DB00157 NADH

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NDUFB1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001188272 – 58NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1Add BLAST57

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75438

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75438

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75438

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75438

PeptideAtlas

More...
PeptideAtlasi
O75438

PRoteomics IDEntifications database

More...
PRIDEi
O75438

ProteomicsDB human proteome resource

More...
ProteomicsDBi
50005
50006 [O75438-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O75438-1 [O75438-1]
O75438-2 [O75438-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75438

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75438

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000183648 Expressed in 228 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_NDUFB1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75438 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75438 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA063737

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Complex I is composed of 45 different subunits.2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110787, 50 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-577 Mitochondrial respiratory chain complex I

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O75438

Protein interaction database and analysis system

More...
IntActi
O75438, 12 interactors

Molecular INTeraction database

More...
MINTi
O75438

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000330787

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5XTCelectron microscopy3.70n3-58[»]
5XTDelectron microscopy3.70n3-58[»]
5XTHelectron microscopy3.90n3-58[»]
5XTIelectron microscopy17.40Bn/n3-58[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75438

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75438

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the complex I NDUFB1 subunit family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J2ZX Eukaryota
ENOG410XXU1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005052

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006501

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75438

KEGG Orthology (KO)

More...
KOi
K03957

Identification of Orthologs from Complete Genome Data

More...
OMAi
CRRGEWQ

Database of Orthologous Groups

More...
OrthoDBi
1624835at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75438

TreeFam database of animal gene trees

More...
TreeFami
TF324446

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012575 NADH_UbQ_OxRdtase_MNLL_su

The PANTHER Classification System

More...
PANTHERi
PTHR15222 PTHR15222, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08040 NADH_oxidored, 1 hit

ProDom; a protein domain database

More...
ProDomi
View protein in ProDom or Entries sharing at least one domain
PD052001 NADH_UbQ_OxRdtase_MNLL_su, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O75438-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVNLLQIVRD HWVHVLVPMG FVIGCYLDRK SDERLTAFRN KSMLFKRELQ

PSEEVTWK
Length:58
Mass (Da):6,961
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2281D89AAE61EA52
GO
Isoform 2 (identifier: O75438-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIM

Show »
Length:105
Mass (Da):11,912
Checksum:iDFC676B23B66E41F
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD42054 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0378591M → MICWRHPSAPCGRGEWQVPR SQLPLARVEFPVALGLGVAV GAEAAAIM in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF054181 mRNA Translation: AAC39914.1
AK316557 Transcribed RNA Translation: BAG48175.1
AL121773 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81479.1
BC009691 mRNA Translation: AAH09691.2
BC126232 mRNA Translation: AAI26233.1
BC126234 mRNA Translation: AAI26235.1
AF050638 mRNA Translation: AAD42054.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9901.1 [O75438-1]

NCBI Reference Sequences

More...
RefSeqi
NP_004536.2, NM_004545.3 [O75438-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.183435

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329559; ENSP00000330787; ENSG00000183648 [O75438-2]
ENST00000553514; ENSP00000451090; ENSG00000183648 [O75438-1]
ENST00000555441; ENSP00000450776; ENSG00000183648 [O75438-1]
ENST00000605997; ENSP00000475170; ENSG00000183648 [O75438-1]
ENST00000617122; ENSP00000483888; ENSG00000183648 [O75438-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4707

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4707

UCSC genome browser

More...
UCSCi
uc001yaf.4 human [O75438-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF054181 mRNA Translation: AAC39914.1
AK316557 Transcribed RNA Translation: BAG48175.1
AL121773 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81479.1
BC009691 mRNA Translation: AAH09691.2
BC126232 mRNA Translation: AAI26233.1
BC126234 mRNA Translation: AAI26235.1
AF050638 mRNA Translation: AAD42054.1 Different initiation.
CCDSiCCDS9901.1 [O75438-1]
RefSeqiNP_004536.2, NM_004545.3 [O75438-2]
UniGeneiHs.183435

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5XTCelectron microscopy3.70n3-58[»]
5XTDelectron microscopy3.70n3-58[»]
5XTHelectron microscopy3.90n3-58[»]
5XTIelectron microscopy17.40Bn/n3-58[»]
ProteinModelPortaliO75438
SMRiO75438
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110787, 50 interactors
ComplexPortaliCPX-577 Mitochondrial respiratory chain complex I
CORUMiO75438
IntActiO75438, 12 interactors
MINTiO75438
STRINGi9606.ENSP00000330787

Chemistry databases

ChEMBLiCHEMBL2363065
DrugBankiDB00157 NADH

PTM databases

iPTMnetiO75438
PhosphoSitePlusiO75438

Polymorphism and mutation databases

BioMutaiNDUFB1

Proteomic databases

EPDiO75438
jPOSTiO75438
MaxQBiO75438
PaxDbiO75438
PeptideAtlasiO75438
PRIDEiO75438
ProteomicsDBi50005
50006 [O75438-2]
TopDownProteomicsiO75438-1 [O75438-1]
O75438-2 [O75438-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4707
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329559; ENSP00000330787; ENSG00000183648 [O75438-2]
ENST00000553514; ENSP00000451090; ENSG00000183648 [O75438-1]
ENST00000555441; ENSP00000450776; ENSG00000183648 [O75438-1]
ENST00000605997; ENSP00000475170; ENSG00000183648 [O75438-1]
ENST00000617122; ENSP00000483888; ENSG00000183648 [O75438-2]
GeneIDi4707
KEGGihsa:4707
UCSCiuc001yaf.4 human [O75438-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4707
EuPathDBiHostDB:ENSG00000183648.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NDUFB1
HGNCiHGNC:7695 NDUFB1
HPAiHPA063737
MIMi603837 gene
neXtProtiNX_O75438
OpenTargetsiENSG00000183648
PharmGKBiPA31501

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J2ZX Eukaryota
ENOG410XXU1 LUCA
GeneTreeiENSGT00390000005052
HOVERGENiHBG006501
InParanoidiO75438
KOiK03957
OMAiCRRGEWQ
OrthoDBi1624835at2759
PhylomeDBiO75438
TreeFamiTF324446

Enzyme and pathway databases

ReactomeiR-HSA-611105 Respiratory electron transport
R-HSA-6799198 Complex I biogenesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NDUFB1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NDUFB1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4707

Protein Ontology

More...
PROi
PR:O75438

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000183648 Expressed in 228 organ(s), highest expression level in corpus callosum
CleanExiHS_NDUFB1
ExpressionAtlasiO75438 baseline and differential
GenevisibleiO75438 HS

Family and domain databases

InterProiView protein in InterPro
IPR012575 NADH_UbQ_OxRdtase_MNLL_su
PANTHERiPTHR15222 PTHR15222, 1 hit
PfamiView protein in Pfam
PF08040 NADH_oxidored, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD052001 NADH_UbQ_OxRdtase_MNLL_su, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNDUB1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75438
Secondary accession number(s): A0AV68
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: January 16, 2019
This is version 149 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again