Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

Gene

NDUFB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.1 Publication

GO - Molecular functioni

  • NADH dehydrogenase (ubiquinone) activity Source: ProtInc

GO - Biological processi

  • mitochondrial electron transport, NADH to ubiquinone Source: UniProtKB
  • mitochondrial respiratory chain complex I assembly Source: UniProtKB

Keywordsi

Biological processElectron transport, Respiratory chain, Transport

Enzyme and pathway databases

ReactomeiR-HSA-611105 Respiratory electron transport
R-HSA-6799198 Complex I biogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Alternative name(s):
Complex I-MNLL
Short name:
CI-MNLL
NADH-ubiquinone oxidoreductase MNLL subunit
Gene namesi
Name:NDUFB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000183648.9
HGNCiHGNC:7695 NDUFB1
MIMi603837 gene
neXtProtiNX_O75438

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei11 – 27HelicalSequence analysisAdd BLAST17

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000183648
PharmGKBiPA31501

Chemistry databases

ChEMBLiCHEMBL2363065
DrugBankiDB00157 NADH

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001188272 – 58NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1Add BLAST57

Proteomic databases

EPDiO75438
MaxQBiO75438
PaxDbiO75438
PeptideAtlasiO75438
PRIDEiO75438
ProteomicsDBi50005
50006 [O75438-2]
TopDownProteomicsiO75438-1 [O75438-1]
O75438-2 [O75438-2]

PTM databases

iPTMnetiO75438
PhosphoSitePlusiO75438

Expressioni

Gene expression databases

BgeeiENSG00000183648 Expressed in 228 organ(s), highest expression level in corpus callosum
CleanExiHS_NDUFB1
ExpressionAtlasiO75438 baseline and differential
GenevisibleiO75438 HS

Organism-specific databases

HPAiHPA063737

Interactioni

Subunit structurei

Complex I is composed of 45 different subunits.2 Publications

Protein-protein interaction databases

BioGridi110787, 50 interactors
ComplexPortaliCPX-577 Mitochondrial respiratory chain complex I
CORUMiO75438
IntActiO75438, 12 interactors
MINTiO75438
STRINGi9606.ENSP00000330787

Structurei

3D structure databases

ProteinModelPortaliO75438
SMRiO75438
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the complex I NDUFB1 subunit family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J2ZX Eukaryota
ENOG410XXU1 LUCA
GeneTreeiENSGT00390000005052
HOVERGENiHBG006501
InParanoidiO75438
KOiK03957
OMAiCRRGEWQ
OrthoDBiEOG091G185E
PhylomeDBiO75438
TreeFamiTF324446

Family and domain databases

InterProiView protein in InterPro
IPR012575 NADH_UbQ_OxRdtase_MNLL_su
PANTHERiPTHR15222 PTHR15222, 1 hit
PfamiView protein in Pfam
PF08040 NADH_oxidored, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD052001 NADH_UbQ_OxRdtase_MNLL_su, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O75438-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVNLLQIVRD HWVHVLVPMG FVIGCYLDRK SDERLTAFRN KSMLFKRELQ

PSEEVTWK
Length:58
Mass (Da):6,961
Last modified:November 1, 1998 - v1
Checksum:i2281D89AAE61EA52
GO
Isoform 2 (identifier: O75438-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIM

Show »
Length:105
Mass (Da):11,912
Checksum:iDFC676B23B66E41F
GO

Sequence cautioni

The sequence AAD42054 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0378591M → MICWRHPSAPCGRGEWQVPR SQLPLARVEFPVALGLGVAV GAEAAAIM in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF054181 mRNA Translation: AAC39914.1
AK316557 Transcribed RNA Translation: BAG48175.1
AL121773 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81479.1
BC009691 mRNA Translation: AAH09691.2
BC126232 mRNA Translation: AAI26233.1
BC126234 mRNA Translation: AAI26235.1
AF050638 mRNA Translation: AAD42054.1 Different initiation.
CCDSiCCDS9901.1 [O75438-2]
RefSeqiNP_004536.2, NM_004545.3 [O75438-2]
UniGeneiHs.183435

Genome annotation databases

EnsembliENST00000329559; ENSP00000330787; ENSG00000183648 [O75438-2]
ENST00000553514; ENSP00000451090; ENSG00000183648 [O75438-1]
ENST00000555441; ENSP00000450776; ENSG00000183648 [O75438-1]
ENST00000605997; ENSP00000475170; ENSG00000183648 [O75438-1]
ENST00000617122; ENSP00000483888; ENSG00000183648 [O75438-2]
GeneIDi4707
KEGGihsa:4707
UCSCiuc001yaf.4 human [O75438-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF054181 mRNA Translation: AAC39914.1
AK316557 Transcribed RNA Translation: BAG48175.1
AL121773 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81479.1
BC009691 mRNA Translation: AAH09691.2
BC126232 mRNA Translation: AAI26233.1
BC126234 mRNA Translation: AAI26235.1
AF050638 mRNA Translation: AAD42054.1 Different initiation.
CCDSiCCDS9901.1 [O75438-2]
RefSeqiNP_004536.2, NM_004545.3 [O75438-2]
UniGeneiHs.183435

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5XTCelectron microscopy3.70n3-58[»]
5XTDelectron microscopy3.70n3-58[»]
5XTHelectron microscopy3.90n3-58[»]
5XTIelectron microscopy17.40Bn/n3-58[»]
ProteinModelPortaliO75438
SMRiO75438
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110787, 50 interactors
ComplexPortaliCPX-577 Mitochondrial respiratory chain complex I
CORUMiO75438
IntActiO75438, 12 interactors
MINTiO75438
STRINGi9606.ENSP00000330787

Chemistry databases

ChEMBLiCHEMBL2363065
DrugBankiDB00157 NADH

PTM databases

iPTMnetiO75438
PhosphoSitePlusiO75438

Proteomic databases

EPDiO75438
MaxQBiO75438
PaxDbiO75438
PeptideAtlasiO75438
PRIDEiO75438
ProteomicsDBi50005
50006 [O75438-2]
TopDownProteomicsiO75438-1 [O75438-1]
O75438-2 [O75438-2]

Protocols and materials databases

DNASUi4707
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329559; ENSP00000330787; ENSG00000183648 [O75438-2]
ENST00000553514; ENSP00000451090; ENSG00000183648 [O75438-1]
ENST00000555441; ENSP00000450776; ENSG00000183648 [O75438-1]
ENST00000605997; ENSP00000475170; ENSG00000183648 [O75438-1]
ENST00000617122; ENSP00000483888; ENSG00000183648 [O75438-2]
GeneIDi4707
KEGGihsa:4707
UCSCiuc001yaf.4 human [O75438-1]

Organism-specific databases

CTDi4707
EuPathDBiHostDB:ENSG00000183648.9
GeneCardsiNDUFB1
HGNCiHGNC:7695 NDUFB1
HPAiHPA063737
MIMi603837 gene
neXtProtiNX_O75438
OpenTargetsiENSG00000183648
PharmGKBiPA31501
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2ZX Eukaryota
ENOG410XXU1 LUCA
GeneTreeiENSGT00390000005052
HOVERGENiHBG006501
InParanoidiO75438
KOiK03957
OMAiCRRGEWQ
OrthoDBiEOG091G185E
PhylomeDBiO75438
TreeFamiTF324446

Enzyme and pathway databases

ReactomeiR-HSA-611105 Respiratory electron transport
R-HSA-6799198 Complex I biogenesis

Miscellaneous databases

ChiTaRSiNDUFB1 human
GeneWikiiNDUFB1
GenomeRNAii4707
PROiPR:O75438
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183648 Expressed in 228 organ(s), highest expression level in corpus callosum
CleanExiHS_NDUFB1
ExpressionAtlasiO75438 baseline and differential
GenevisibleiO75438 HS

Family and domain databases

InterProiView protein in InterPro
IPR012575 NADH_UbQ_OxRdtase_MNLL_su
PANTHERiPTHR15222 PTHR15222, 1 hit
PfamiView protein in Pfam
PF08040 NADH_oxidored, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD052001 NADH_UbQ_OxRdtase_MNLL_su, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNDUB1_HUMAN
AccessioniPrimary (citable) accession number: O75438
Secondary accession number(s): A0AV68
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 1, 1998
Last modified: November 7, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again