Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box only protein 24

Gene

FBXO24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

GO - Molecular functioni

  • ubiquitin-protein transferase activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processUbl conjugation pathway

Names & Taxonomyi

Protein namesi
Recommended name:
F-box only protein 24
Gene namesi
Name:FBXO24
Synonyms:FBX24
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000106336.12
HGNCiHGNC:13595 FBXO24
MIMi609097 gene
neXtProtiNX_O75426

Subcellular locationi

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000106336
PharmGKBiPA28037

Polymorphism and mutation databases

BioMutaiFBXO24

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001199091 – 580F-box only protein 24Add BLAST580

Proteomic databases

PaxDbiO75426
PeptideAtlasiO75426
PRIDEiO75426
ProteomicsDBi49996
49997 [O75426-2]
49998 [O75426-3]
49999 [O75426-4]

PTM databases

iPTMnetiO75426
PhosphoSitePlusiO75426

Expressioni

Gene expression databases

BgeeiENSG00000106336 Expressed in 125 organ(s), highest expression level in right testis
CleanExiHS_FBXO24
ExpressionAtlasiO75426 baseline and differential
GenevisibleiO75426 HS

Organism-specific databases

HPAiHPA050951

Interactioni

Subunit structurei

Directly interacts with SKP1 and CUL1.By similarity

Binary interactionsi

Protein-protein interaction databases

BioGridi117647, 8 interactors
IntActiO75426, 16 interactors
STRINGi9606.ENSP00000416558

Structurei

3D structure databases

ProteinModelPortaliO75426
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 82F-boxPROSITE-ProRule annotationAdd BLAST47
Repeati376 – 425RCC1Add BLAST50

Phylogenomic databases

eggNOGiENOG410IQCV Eukaryota
ENOG41100N3 LUCA
GeneTreeiENSGT00390000017455
HOGENOMiHOG000253007
HOVERGENiHBG051571
InParanoidiO75426
KOiK10304
OMAiHDIEHHP
OrthoDBiEOG091G043B
PhylomeDBiO75426
TreeFamiTF328722

Family and domain databases

Gene3Di2.130.10.30, 1 hit
InterProiView protein in InterPro
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR009091 RCC1/BLIP-II
IPR000408 Reg_chr_condens
PfamiView protein in Pfam
PF12937 F-box-like, 1 hit
PF00415 RCC1, 1 hit
SMARTiView protein in SMART
SM00256 FBOX, 1 hit
SUPFAMiSSF50985 SSF50985, 1 hit
SSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS50181 FBOX, 1 hit
PS50012 RCC1_3, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75426-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEKAVPLLR RRRVKRSCPS CGSELGVEEK RGKGNPISIQ LFPPELVEHI
60 70 80 90 100
ISFLPVRDLV ALGQTCRYFH EVCDGEGVWR RICRRLSPRL QDQGSGVRPW
110 120 130 140 150
KRAAILNYTK GLYFQAFGGR RRCLSKSVAP LLAHGYRRFL PTKDHVFILD
160 170 180 190 200
YVGTLFFLKN ALVSTLGQMQ WKRACRYVVL CRGAKDFASD PRCDTVYRKY
210 220 230 240 250
LYVLATREPQ EVVGTTSSRA CDCVEVYLQS SGQRVFKMTF HHSMTFKQIV
260 270 280 290 300
LVGQETQRAL LLLTEEGKIY SLVVNETQLD QPRSYTVQLA LRKVSHYLPH
310 320 330 340 350
LRVACMTSNQ SSTLYVTDQG GVYFEVHTPG VYRDLFGTLQ AFDPLDQQMP
360 370 380 390 400
LALSLPAKIL FCALGYNHLG LVDEFGRIFM QGNNRYGQLG TGDKMDRGEP
410 420 430 440 450
TQVCYLQRPI TLWCGLNHSL VLSQSSEFSK ELLGCGCGAG GRLPGWPKGS
460 470 480 490 500
ASFVKLQVKV PLCACALCAT RECLYILSSH DIEQHAPYRH LPASRVVGTP
510 520 530 540 550
EPSLGARAPQ DPGGMAQACE EYLSQIHSCQ TLQDRTEKMK EIVGWMPLMA
560 570 580
AQKDFFWEAL DMLQRAEGGG GGVGPPAPET
Length:580
Mass (Da):64,889
Last modified:August 16, 2004 - v2
Checksum:i3863C6846AB6B940
GO
Isoform 2 (identifier: O75426-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     94-108: GSGVRPWKRAAILNY → D
     319-332: QGGVYFEVHTPGVY → PILCSWLQPPWPGG
     333-580: Missing.

Show »
Length:318
Mass (Da):36,353
Checksum:i025D9AF7342646F2
GO
Isoform 3 (identifier: O75426-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MGEKAVPLLRRR → MVWESQQERGGQGPRRQEGRSREGAIRMVRGSQRRKLQKFTRLCGREEGL

Note: No experimental confirmation available.
Show »
Length:618
Mass (Da):69,336
Checksum:i5F6E800F4AF66B0E
GO
Isoform 4 (identifier: O75426-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGEKAVPLLRRRR → M

Note: No experimental confirmation available.
Show »
Length:568
Mass (Da):63,456
Checksum:iD6E1D0FBBB60538A
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J4S8C9J4S8_HUMAN
F-box only protein 24
FBXO24
187Annotation score:
C9K0U2C9K0U2_HUMAN
F-box only protein 24
FBXO24
130Annotation score:
F8WC52F8WC52_HUMAN
F-box only protein 24
FBXO24
37Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049042302R → H. Corresponds to variant dbSNP:rs7801492Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0434581 – 13MGEKA…LRRRR → M in isoform 4. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0434591 – 12MGEKA…LLRRR → MVWESQQERGGQGPRRQEGR SREGAIRMVRGSQRRKLQKF TRLCGREEGL in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_01135194 – 108GSGVR…AILNY → D in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_011352319 – 332QGGVY…TPGVY → PILCSWLQPPWPGG in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_011353333 – 580Missing in isoform 2. 1 PublicationAdd BLAST248

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF174604 mRNA Translation: AAF04525.1
AF053356 Genomic DNA Translation: AAC78801.1
AL136811 mRNA Translation: CAB66745.1
AK301864 mRNA Translation: BAG63303.1
AK302252 mRNA Translation: BAG63604.1
AC069281 Genomic DNA Translation: AAP21862.1
AC069281 Genomic DNA Translation: AAP21863.1
CH236956 Genomic DNA Translation: EAL23827.1
CH471091 Genomic DNA Translation: EAW76517.1
BC067293 mRNA Translation: AAH67293.1
CCDSiCCDS55138.1 [O75426-4]
CCDS5698.1 [O75426-1]
CCDS5699.2 [O75426-3]
RefSeqiNP_001156971.1, NM_001163499.1 [O75426-4]
NP_036304.2, NM_012172.4 [O75426-3]
NP_277041.1, NM_033506.2 [O75426-1]
UniGeneiHs.283764

Genome annotation databases

EnsembliENST00000241071; ENSP00000241071; ENSG00000106336 [O75426-1]
ENST00000427939; ENSP00000416558; ENSG00000106336 [O75426-3]
ENST00000465843; ENSP00000419602; ENSG00000106336 [O75426-2]
ENST00000468962; ENSP00000420239; ENSG00000106336 [O75426-4]
GeneIDi26261
KEGGihsa:26261
UCSCiuc003uvl.2 human [O75426-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF174604 mRNA Translation: AAF04525.1
AF053356 Genomic DNA Translation: AAC78801.1
AL136811 mRNA Translation: CAB66745.1
AK301864 mRNA Translation: BAG63303.1
AK302252 mRNA Translation: BAG63604.1
AC069281 Genomic DNA Translation: AAP21862.1
AC069281 Genomic DNA Translation: AAP21863.1
CH236956 Genomic DNA Translation: EAL23827.1
CH471091 Genomic DNA Translation: EAW76517.1
BC067293 mRNA Translation: AAH67293.1
CCDSiCCDS55138.1 [O75426-4]
CCDS5698.1 [O75426-1]
CCDS5699.2 [O75426-3]
RefSeqiNP_001156971.1, NM_001163499.1 [O75426-4]
NP_036304.2, NM_012172.4 [O75426-3]
NP_277041.1, NM_033506.2 [O75426-1]
UniGeneiHs.283764

3D structure databases

ProteinModelPortaliO75426
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117647, 8 interactors
IntActiO75426, 16 interactors
STRINGi9606.ENSP00000416558

PTM databases

iPTMnetiO75426
PhosphoSitePlusiO75426

Polymorphism and mutation databases

BioMutaiFBXO24

Proteomic databases

PaxDbiO75426
PeptideAtlasiO75426
PRIDEiO75426
ProteomicsDBi49996
49997 [O75426-2]
49998 [O75426-3]
49999 [O75426-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000241071; ENSP00000241071; ENSG00000106336 [O75426-1]
ENST00000427939; ENSP00000416558; ENSG00000106336 [O75426-3]
ENST00000465843; ENSP00000419602; ENSG00000106336 [O75426-2]
ENST00000468962; ENSP00000420239; ENSG00000106336 [O75426-4]
GeneIDi26261
KEGGihsa:26261
UCSCiuc003uvl.2 human [O75426-1]

Organism-specific databases

CTDi26261
EuPathDBiHostDB:ENSG00000106336.12
GeneCardsiFBXO24
HGNCiHGNC:13595 FBXO24
HPAiHPA050951
MIMi609097 gene
neXtProtiNX_O75426
OpenTargetsiENSG00000106336
PharmGKBiPA28037
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQCV Eukaryota
ENOG41100N3 LUCA
GeneTreeiENSGT00390000017455
HOGENOMiHOG000253007
HOVERGENiHBG051571
InParanoidiO75426
KOiK10304
OMAiHDIEHHP
OrthoDBiEOG091G043B
PhylomeDBiO75426
TreeFamiTF328722

Miscellaneous databases

ChiTaRSiFBXO24 human
GenomeRNAii26261
PROiPR:O75426
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106336 Expressed in 125 organ(s), highest expression level in right testis
CleanExiHS_FBXO24
ExpressionAtlasiO75426 baseline and differential
GenevisibleiO75426 HS

Family and domain databases

Gene3Di2.130.10.30, 1 hit
InterProiView protein in InterPro
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR009091 RCC1/BLIP-II
IPR000408 Reg_chr_condens
PfamiView protein in Pfam
PF12937 F-box-like, 1 hit
PF00415 RCC1, 1 hit
SMARTiView protein in SMART
SM00256 FBOX, 1 hit
SUPFAMiSSF50985 SSF50985, 1 hit
SSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS50181 FBOX, 1 hit
PS50012 RCC1_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFBX24_HUMAN
AccessioniPrimary (citable) accession number: O75426
Secondary accession number(s): A4D2D4
, B4DX91, B4DY42, Q9H0G1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: August 16, 2004
Last modified: November 7, 2018
This is version 147 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again