Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O75426 (FBX24_HUMAN)

Entry version 160 (10 Feb 2021)
Sequence version 2 (16 Aug 2004)
Previous versions | rss
Add a publicationFeedback
Protein

F-box only protein 24

Gene

FBXO24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O75426

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
F-box only protein 24
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FBXO24
Synonyms:FBX24
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:13595, FBXO24

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609097, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75426

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000106336.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		26261

Open Targets

More...OpenTargetsi		ENSG00000106336

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28037

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75426, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FBXO24

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001199091 – 580F-box only protein 24Add BLAST580

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75426

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75426

PeptideAtlas

More...PeptideAtlasi		O75426

PRoteomics IDEntifications database

More...PRIDEi		O75426

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		49996 [O75426-1]
49997 [O75426-2]
49998 [O75426-3]
49999 [O75426-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75426

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75426

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000106336, Expressed in right testis and 144 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75426, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75426, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000106336, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Directly interacts with SKP1 and CUL1.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117647, 8 interactors

Protein interaction database and analysis system

More...IntActi		O75426, 16 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000416558

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75426, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini36 – 82F-boxPROSITE-ProRule annotationAdd BLAST47
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati376 – 425RCC1Add BLAST50

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0274, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000017455

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_032821_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75426

Identification of Orthologs from Complete Genome Data

More...OMAi		SCCLPHL

Database of Orthologous Groups

More...OrthoDBi		379673at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75426

TreeFam database of animal gene trees

More...TreeFami		TF328722

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR036047, F-box-like_dom_sf
IPR001810, F-box_dom
IPR009091, RCC1/BLIP-II
IPR000408, Reg_chr_condens

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12937, F-box-like, 1 hit
PF00415, RCC1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00256, FBOX, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50985, SSF50985, 1 hit
SSF81383, SSF81383, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50181, FBOX, 1 hit
PS50012, RCC1_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75426-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEKAVPLLR RRRVKRSCPS CGSELGVEEK RGKGNPISIQ LFPPELVEHI 
        60         70         80         90        100
ISFLPVRDLV ALGQTCRYFH EVCDGEGVWR RICRRLSPRL QDQGSGVRPW 
       110        120        130        140        150
KRAAILNYTK GLYFQAFGGR RRCLSKSVAP LLAHGYRRFL PTKDHVFILD 
       160        170        180        190        200
YVGTLFFLKN ALVSTLGQMQ WKRACRYVVL CRGAKDFASD PRCDTVYRKY 
       210        220        230        240        250
LYVLATREPQ EVVGTTSSRA CDCVEVYLQS SGQRVFKMTF HHSMTFKQIV 
       260        270        280        290        300
LVGQETQRAL LLLTEEGKIY SLVVNETQLD QPRSYTVQLA LRKVSHYLPH 
       310        320        330        340        350
LRVACMTSNQ SSTLYVTDQG GVYFEVHTPG VYRDLFGTLQ AFDPLDQQMP 
       360        370        380        390        400
LALSLPAKIL FCALGYNHLG LVDEFGRIFM QGNNRYGQLG TGDKMDRGEP 
       410        420        430        440        450
TQVCYLQRPI TLWCGLNHSL VLSQSSEFSK ELLGCGCGAG GRLPGWPKGS 
       460        470        480        490        500
ASFVKLQVKV PLCACALCAT RECLYILSSH DIEQHAPYRH LPASRVVGTP 
       510        520        530        540        550
EPSLGARAPQ DPGGMAQACE EYLSQIHSCQ TLQDRTEKMK EIVGWMPLMA 
       560        570        580
AQKDFFWEAL DMLQRAEGGG GGVGPPAPET
Length:580
Mass (Da):64,889
Last modified:August 16, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3863C6846AB6B940
GO
Isoform 2 (identifier: O75426-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     94-108: GSGVRPWKRAAILNY → D
     319-332: QGGVYFEVHTPGVY → PILCSWLQPPWPGG
     333-580: Missing.

Show »
Length:318
Mass (Da):36,353
Checksum:i025D9AF7342646F2
GO
Isoform 3 (identifier: O75426-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MGEKAVPLLRRR → MVWESQQERGGQGPRRQEGRSREGAIRMVRGSQRRKLQKFTRLCGREEGL

Show »
Length:618
Mass (Da):69,336
Checksum:i5F6E800F4AF66B0E
GO
Isoform 4 (identifier: O75426-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGEKAVPLLRRRR → M

Show »
Length:568
Mass (Da):63,456
Checksum:iD6E1D0FBBB60538A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9K0U2C9K0U2_HUMAN
F-box only protein 24
FBXO24
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J4S8C9J4S8_HUMAN
F-box only protein 24
FBXO24
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC52F8WC52_HUMAN
F-box only protein 24
FBXO24
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049042302R → H. Corresponds to variant dbSNP:rs7801492Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0434581 – 13MGEKA…LRRRR → M in isoform 4. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_0434591 – 12MGEKA…LLRRR → MVWESQQERGGQGPRRQEGR SREGAIRMVRGSQRRKLQKF TRLCGREEGL in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_01135194 – 108GSGVR…AILNY → D in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_011352319 – 332QGGVY…TPGVY → PILCSWLQPPWPGG in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_011353333 – 580Missing in isoform 2. 1 PublicationAdd BLAST248

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF174604 mRNA Translation: AAF04525.1
AF053356 Genomic DNA Translation: AAC78801.1
AL136811 mRNA Translation: CAB66745.1
AK301864 mRNA Translation: BAG63303.1
AK302252 mRNA Translation: BAG63604.1
AC069281 Genomic DNA Translation: AAP21862.1
AC069281 Genomic DNA Translation: AAP21863.1
CH236956 Genomic DNA Translation: EAL23827.1
CH471091 Genomic DNA Translation: EAW76517.1
BC067293 mRNA Translation: AAH67293.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55138.1 [O75426-4]
CCDS5698.1 [O75426-1]
CCDS5699.2 [O75426-3]

NCBI Reference Sequences

More...RefSeqi		NP_001156971.1, NM_001163499.1 [O75426-4]
NP_036304.2, NM_012172.4 [O75426-3]
NP_277041.1, NM_033506.2 [O75426-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000241071; ENSP00000241071; ENSG00000106336 [O75426-1]
ENST00000427939; ENSP00000416558; ENSG00000106336 [O75426-3]
ENST00000465843; ENSP00000419602; ENSG00000106336 [O75426-2]
ENST00000468962; ENSP00000420239; ENSG00000106336 [O75426-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		26261

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:26261

UCSC genome browser

More...UCSCi		uc003uvl.2, human [O75426-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF174604 mRNA Translation: AAF04525.1
AF053356 Genomic DNA Translation: AAC78801.1
AL136811 mRNA Translation: CAB66745.1
AK301864 mRNA Translation: BAG63303.1
AK302252 mRNA Translation: BAG63604.1
AC069281 Genomic DNA Translation: AAP21862.1
AC069281 Genomic DNA Translation: AAP21863.1
CH236956 Genomic DNA Translation: EAL23827.1
CH471091 Genomic DNA Translation: EAW76517.1
BC067293 mRNA Translation: AAH67293.1
CCDSiCCDS55138.1 [O75426-4]
CCDS5698.1 [O75426-1]
CCDS5699.2 [O75426-3]
RefSeqiNP_001156971.1, NM_001163499.1 [O75426-4]
NP_036304.2, NM_012172.4 [O75426-3]
NP_277041.1, NM_033506.2 [O75426-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi117647, 8 interactors
IntActiO75426, 16 interactors
STRINGi9606.ENSP00000416558

PTM databases

iPTMnetiO75426
PhosphoSitePlusiO75426

Genetic variation databases

BioMutaiFBXO24

Proteomic databases

MassIVEiO75426
PaxDbiO75426
PeptideAtlasiO75426
PRIDEiO75426
ProteomicsDBi49996 [O75426-1]
49997 [O75426-2]
49998 [O75426-3]
49999 [O75426-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		30754, 220 antibodies

Genome annotation databases

EnsembliENST00000241071; ENSP00000241071; ENSG00000106336 [O75426-1]
ENST00000427939; ENSP00000416558; ENSG00000106336 [O75426-3]
ENST00000465843; ENSP00000419602; ENSG00000106336 [O75426-2]
ENST00000468962; ENSP00000420239; ENSG00000106336 [O75426-4]
GeneIDi26261
KEGGihsa:26261
UCSCiuc003uvl.2, human [O75426-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		26261
DisGeNETi26261

GeneCards: human genes, protein and diseases

More...GeneCardsi		FBXO24
HGNCiHGNC:13595, FBXO24
HPAiENSG00000106336, Tissue enriched (testis)
MIMi609097, gene
neXtProtiNX_O75426
OpenTargetsiENSG00000106336
PharmGKBiPA28037
VEuPathDBiHostDB:ENSG00000106336.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0274, Eukaryota
GeneTreeiENSGT00390000017455
HOGENOMiCLU_032821_0_0_1
InParanoidiO75426
OMAiSCCLPHL
OrthoDBi379673at2759
PhylomeDBiO75426
TreeFamiTF328722

Enzyme and pathway databases

PathwayCommonsiO75426

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		26261, 6 hits in 875 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FBXO24, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		26261
PharosiO75426, Tdark

Protein Ontology

More...PROi		PR:O75426
RNActiO75426, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000106336, Expressed in right testis and 144 other tissues
ExpressionAtlasiO75426, baseline and differential
GenevisibleiO75426, HS

Family and domain databases

Gene3Di2.130.10.30, 1 hit
InterProiView protein in InterPro
IPR036047, F-box-like_dom_sf
IPR001810, F-box_dom
IPR009091, RCC1/BLIP-II
IPR000408, Reg_chr_condens
PfamiView protein in Pfam
PF12937, F-box-like, 1 hit
PF00415, RCC1, 1 hit
SMARTiView protein in SMART
SM00256, FBOX, 1 hit
SUPFAMiSSF50985, SSF50985, 1 hit
SSF81383, SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS50181, FBOX, 1 hit
PS50012, RCC1_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFBX24_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75426
Secondary accession number(s): A4D2D4
, B4DX91, B4DY42, Q9H0G1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: August 16, 2004
Last modified: February 10, 2021
This is version 160 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again