Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O75419 (CDC45_HUMAN)

Entry version 185 (02 Jun 2021)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Cell division control protein 45 homolog

Gene

CDC45

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for initiation of chromosomal DNA replication.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, DNA replication

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O75419

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-176187, Activation of ATR in response to replication stress
R-HSA-176974, Unwinding of DNA
R-HSA-68962, Activation of the pre-replicative complex
R-HSA-69205, G1/S-Specific Transcription

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cell division control protein 45 homolog
Alternative name(s):
PORC-PI-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDC45
Synonyms:CDC45L, CDC45L2
ORF Names:UNQ374/PRO710
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1739, CDC45

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603465, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75419

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000093009.9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Meier-Gorlin syndrome 7 (MGORS7)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of Meier-Gorlin syndrome, a syndrome characterized by bilateral microtia, aplasia/hypoplasia of the patellae, and severe intrauterine and postnatal growth retardation with short stature and poor weight gain. Additional clinical findings include anomalies of cranial sutures, microcephaly, apparently low-set and simple ears, microstomia, full lips, highly arched or cleft palate, micrognathia, genitourinary tract anomalies, and various skeletal anomalies. While almost all cases have primordial dwarfism with substantial prenatal and postnatal growth retardation, not all cases have microcephaly, and microtia and absent/hypoplastic patella are absent in some. Despite the presence of microcephaly, intellect is usually normal. MGORS7 inheritance is autosomal recessive.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08096368Q → R in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs879255633EnsemblClinVar.1
Natural variantiVAR_08096476N → H in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs879255632EnsemblClinVar.1
Natural variantiVAR_080965155E → G in MGORS7; unknown pathological significance; associated in cis with T-321. 1 PublicationCorresponds to variant dbSNP:rs9606030Ensembl.1
Natural variantiVAR_080966157R → C in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs540217942EnsemblClinVar.1
Natural variantiVAR_080967226D → G in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs754080445Ensembl.1
Natural variantiVAR_080968264S → Y in MGORS7; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs151279621Ensembl.1
Natural variantiVAR_080969298A → V in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs146559223Ensembl.1
Natural variantiVAR_080970321P → T in MGORS7; unknown pathological significance; associated in cis with G-155. 1 Publication1
Natural variantiVAR_080971424 – 566Missing in MGORS7; unknown pathological significance. 1 PublicationAdd BLAST143
Natural variantiVAR_080972463P → L in MGORS7; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs751663397Ensembl.1
Natural variantiVAR_080973496P → L in MGORS7; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1376596361Ensembl.1
Natural variantiVAR_080974554R → W in MGORS7; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs778665661Ensembl.1

Keywords - Diseasei

Disease variant, Dwarfism

Organism-specific databases

DisGeNET

More...DisGeNETi		8318

MalaCards human disease database

More...MalaCardsi		CDC45
MIMi617063, phenotype

Open Targets

More...OpenTargetsi		ENSG00000093009

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2554, Ear-patella-short stature syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA371

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75419, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3040

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CDC45

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001928151 – 566Cell division control protein 45 homologAdd BLAST566

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei130PhosphotyrosineCombined sources1
Modified residuei144PhosphoserineCombined sources1
Modified residuei148PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O75419

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O75419

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75419

MaxQB - The MaxQuant DataBase

More...MaxQBi		O75419

PeptideAtlas

More...PeptideAtlasi		O75419

PRoteomics IDEntifications database

More...PRIDEi		O75419

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		19667
49990 [O75419-1]
49991 [O75419-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75419

MetOSite database of methionine sulfoxide sites

More...MetOSitei		O75419

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75419

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, highest levels are found in adult testis and thymus and in fetal liver.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Transcript peaks at G1-S transition, but total protein remains constant throughout the cell cycle. Expressed in multiple tissues during embryogenesis, including neural crest-derived structures.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000093009, Expressed in oocyte and 129 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75419, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75419, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000093009, Tissue enhanced (bone marrow, lymphoid tissue, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associated with ORC2.

Interacts with HELB (PubMed:25933514).

Component of the CMG helicase complex, composed of the MCM2-7 complex, the GINS complex and CDC45 (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113915, 70 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-4526, CMG helicase complex

Database of interacting proteins

More...DIPi		DIP-31725N

Protein interaction database and analysis system

More...IntActi		O75419, 36 interactors

Molecular INTeraction database

More...MINTi		O75419

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000405726

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O75419

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75419, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1566
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O75419

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni136 – 163DisorderedSequence analysisAdd BLAST28

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi147 – 163Basic and acidic residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CDC45 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2475, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000009662

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_005871_4_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75419

Identification of Orthologs from Complete Genome Data

More...OMAi		PWNLANV

Database of Orthologous Groups

More...OrthoDBi		1309031at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75419

TreeFam database of animal gene trees

More...TreeFami		TF101062

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003874, CDC45

The PANTHER Classification System

More...PANTHERi		PTHR10507, PTHR10507, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02724, CDC45, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75419-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFVSDFRKEF YEVVQSQRVL LFVASDVDAL CACKILQALF QCDHVQYTLV 
        60         70         80         90        100
PVSGWQELET AFLEHKEQFH YFILINCGAN VDLLDILQPD EDTIFFVCDT 
       110        120        130        140        150
HRPVNVVNVY NDTQIKLLIK QDDDLEVPAY EDIFRDEEED EEHSGNDSDG 
       160        170        180        190        200
SEPSEKRTRL EEEIVEQTMR RRQRREWEAR RRDILFDYEQ YEYHGTSSAM 
       210        220        230        240        250
VMFELAWMLS KDLNDMLWWA IVGLTDQWVQ DKITQMKYVT DVGVLQRHVS 
       260        270        280        290        300
RHNHRNEDEE NTLSVDCTRI SFEYDLRLVL YQHWSLHDSL CNTSYTAARF 
       310        320        330        340        350
KLWSVHGQKR LQEFLADMGL PLKQVKQKFQ AMDISLKENL REMIEESANK 
       360        370        380        390        400
FGMKDMRVQT FSIHFGFKHK FLASDVVFAT MSLMESPEKD GSGTDHFIQA 
       410        420        430        440        450
LDSLSRSNLD KLYHGLELAK KQLRATQQTI ASCLCTNLVI SQGPFLYCSL 
       460        470        480        490        500
MEGTPDVMLF SRPASLSLLS KHLLKSFVCS TKNRRCKLLP LVMAAPLSME 
       510        520        530        540        550
HGTVTVVGIP PETDSSDRKN FFGRAFEKAA ESTSSRMLHN HFDLSVIELK 
       560 
AEDRSKFLDA LISLLS
Length:566
Mass (Da):65,569
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAE1BE2C8C8E5F867
GO
Isoform 2 (identifier: O75419-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.

Show »
Length:520
Mass (Da):60,245
Checksum:iBE5CE1F95079C2E6
GO
Isoform 3 (identifier: O75419-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     180-180: R → RSGSGSEPVAAALEKSSRLFAGPMSDRTAPRSP

Show »
Length:598
Mass (Da):68,768
Checksum:i2625590397EB6E6B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BZ91H7BZ91_HUMAN
Cell division control protein 45 ho...
CDC45
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZH29A0A5F9ZH29_HUMAN
Cell division control protein 45 ho...
CDC45
371Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9K087C9K087_HUMAN
Cell division control protein 45 ho...
CDC45
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J911C9J911_HUMAN
Cell division control protein 45 ho...
CDC45
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZI22A0A5F9ZI22_HUMAN
Cell division control protein 45 ho...
CDC45
327Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5K1VW85A0A5K1VW85_HUMAN
Cell division control protein 45 ho...
CDC45
398Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti100T → S in AAQ89330 (PubMed:12975309).Curated1
Sequence conflicti115I → V in CAA11530 (PubMed:9724329).Curated1
Sequence conflicti346E → Q in AAC67521 (PubMed:9755170).Curated1
Sequence conflicti509I → F in BAG56854 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08096368Q → R in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs879255633EnsemblClinVar.1
Natural variantiVAR_08096476N → H in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs879255632EnsemblClinVar.1
Natural variantiVAR_01928681V → I1 PublicationCorresponds to variant dbSNP:rs13447203EnsemblClinVar.1
Natural variantiVAR_080965155E → G in MGORS7; unknown pathological significance; associated in cis with T-321. 1 PublicationCorresponds to variant dbSNP:rs9606030Ensembl.1
Natural variantiVAR_080966157R → C in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs540217942EnsemblClinVar.1
Natural variantiVAR_080967226D → G in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs754080445Ensembl.1
Natural variantiVAR_080968264S → Y in MGORS7; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs151279621Ensembl.1
Natural variantiVAR_080969298A → V in MGORS7; decreased protein level. 1 PublicationCorresponds to variant dbSNP:rs146559223Ensembl.1
Natural variantiVAR_080970321P → T in MGORS7; unknown pathological significance; associated in cis with G-155. 1 Publication1
Natural variantiVAR_053026356M → R. Corresponds to variant dbSNP:rs17209274Ensembl.1
Natural variantiVAR_019287376V → M1 PublicationCorresponds to variant dbSNP:rs13447263Ensembl.1
Natural variantiVAR_080971424 – 566Missing in MGORS7; unknown pathological significance. 1 PublicationAdd BLAST143
Natural variantiVAR_080972463P → L in MGORS7; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs751663397Ensembl.1
Natural variantiVAR_080973496P → L in MGORS7; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1376596361Ensembl.1
Natural variantiVAR_080974554R → W in MGORS7; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs778665661Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04312968 – 113Missing in isoform 2. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_045411180R → RSGSGSEPVAAALEKSSRLF AGPMSDRTAPRSP in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF062495 mRNA Translation: AAC67521.1
AF053074 mRNA Translation: AAC27289.1
AJ223728 mRNA Translation: CAA11530.1
AF081535 mRNA Translation: AAD08998.1
AY358971 mRNA Translation: AAQ89330.1
AK293123 mRNA Translation: BAG56675.1
AK293338 mRNA Translation: BAG56854.1
BT006792 mRNA Translation: AAP35438.1
AY572790 Genomic DNA Translation: AAS66985.1
CT841513 mRNA Translation: CAJ86443.1
AC000082 Genomic DNA No translation available.
AC000087 Genomic DNA No translation available.
AC000088 Genomic DNA No translation available.
CH471176 Genomic DNA Translation: EAX03036.1
BC006232 mRNA Translation: AAH06232.1
BC010022 mRNA Translation: AAH10022.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13762.1 [O75419-1]
CCDS54499.1 [O75419-3]
CCDS54500.1 [O75419-2]

NCBI Reference Sequences

More...RefSeqi		NP_001171481.1, NM_001178010.2 [O75419-3]
NP_001171482.1, NM_001178011.2 [O75419-2]
NP_003495.1, NM_003504.4 [O75419-1]
XP_005261342.1, XM_005261285.2
XP_011528717.1, XM_011530415.1
XP_011528720.1, XM_011530418.2 [O75419-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000263201; ENSP00000263201; ENSG00000093009 [O75419-1]
ENST00000404724; ENSP00000384978; ENSG00000093009 [O75419-2]
ENST00000437685; ENSP00000405726; ENSG00000093009 [O75419-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8318

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8318

UCSC genome browser

More...UCSCi		uc002zpr.5, human [O75419-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062495 mRNA Translation: AAC67521.1
AF053074 mRNA Translation: AAC27289.1
AJ223728 mRNA Translation: CAA11530.1
AF081535 mRNA Translation: AAD08998.1
AY358971 mRNA Translation: AAQ89330.1
AK293123 mRNA Translation: BAG56675.1
AK293338 mRNA Translation: BAG56854.1
BT006792 mRNA Translation: AAP35438.1
AY572790 Genomic DNA Translation: AAS66985.1
CT841513 mRNA Translation: CAJ86443.1
AC000082 Genomic DNA No translation available.
AC000087 Genomic DNA No translation available.
AC000088 Genomic DNA No translation available.
CH471176 Genomic DNA Translation: EAX03036.1
BC006232 mRNA Translation: AAH06232.1
BC010022 mRNA Translation: AAH10022.1
CCDSiCCDS13762.1 [O75419-1]
CCDS54499.1 [O75419-3]
CCDS54500.1 [O75419-2]
RefSeqiNP_001171481.1, NM_001178010.2 [O75419-3]
NP_001171482.1, NM_001178011.2 [O75419-2]
NP_003495.1, NM_003504.4 [O75419-1]
XP_005261342.1, XM_005261285.2
XP_011528717.1, XM_011530415.1
XP_011528720.1, XM_011530418.2 [O75419-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5DGOX-ray2.10A1-566[»]
6XTXelectron microscopy3.29E1-566[»]
6XTYelectron microscopy6.77E1-566[»]
SMRiO75419
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113915, 70 interactors
ComplexPortaliCPX-4526, CMG helicase complex
DIPiDIP-31725N
IntActiO75419, 36 interactors
MINTiO75419
STRINGi9606.ENSP00000405726

Chemistry databases

BindingDBiO75419
ChEMBLiCHEMBL3040

PTM databases

iPTMnetiO75419
MetOSiteiO75419
PhosphoSitePlusiO75419

Genetic variation databases

BioMutaiCDC45

Proteomic databases

EPDiO75419
jPOSTiO75419
MassIVEiO75419
MaxQBiO75419
PeptideAtlasiO75419
PRIDEiO75419
ProteomicsDBi19667
49990 [O75419-1]
49991 [O75419-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		262, 359 antibodies

The DNASU plasmid repository

More...DNASUi		8318

Genome annotation databases

EnsembliENST00000263201; ENSP00000263201; ENSG00000093009 [O75419-1]
ENST00000404724; ENSP00000384978; ENSG00000093009 [O75419-2]
ENST00000437685; ENSP00000405726; ENSG00000093009 [O75419-3]
GeneIDi8318
KEGGihsa:8318
UCSCiuc002zpr.5, human [O75419-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8318
DisGeNETi8318

GeneCards: human genes, protein and diseases

More...GeneCardsi		CDC45
HGNCiHGNC:1739, CDC45
HPAiENSG00000093009, Tissue enhanced (bone marrow, lymphoid tissue, testis)
MalaCardsiCDC45
MIMi603465, gene
617063, phenotype
neXtProtiNX_O75419
OpenTargetsiENSG00000093009
Orphaneti2554, Ear-patella-short stature syndrome
PharmGKBiPA371
VEuPathDBiHostDB:ENSG00000093009.9

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2475, Eukaryota
GeneTreeiENSGT00390000009662
HOGENOMiCLU_005871_4_0_1
InParanoidiO75419
OMAiPWNLANV
OrthoDBi1309031at2759
PhylomeDBiO75419
TreeFamiTF101062

Enzyme and pathway databases

PathwayCommonsiO75419
ReactomeiR-HSA-176187, Activation of ATR in response to replication stress
R-HSA-176974, Unwinding of DNA
R-HSA-68962, Activation of the pre-replicative complex
R-HSA-69205, G1/S-Specific Transcription

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8318, 798 hits in 1006 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CDC45, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CDC45-related_protein

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8318
PharosiO75419, Tbio

Protein Ontology

More...PROi		PR:O75419
RNActiO75419, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000093009, Expressed in oocyte and 129 other tissues
ExpressionAtlasiO75419, baseline and differential
GenevisibleiO75419, HS

Family and domain databases

InterProiView protein in InterPro
IPR003874, CDC45
PANTHERiPTHR10507, PTHR10507, 1 hit
PfamiView protein in Pfam
PF02724, CDC45, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCDC45_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75419
Secondary accession number(s): B4DDB4
, B4DDU3, E9PDH7, O60856, Q20WK8, Q6UW54, Q9UP68
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1998
Last modified: June 2, 2021
This is version 185 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again