UniProtKB - O75391 (SPAG7_HUMAN)

BLAST

>sp|O75391|SPAG7_HUMAN Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2
MADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFI
QDSGQIKKKFQPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDS
YRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAA
HMLQANKTYGCVPVANKRDTRSIEEAMNEIRAKKRLRQSGEELPPTS

Align
Format
Add to basket Added to basket
History
Entry version 139 (07 Nov 2018)
Sequence version 2 (29 Mar 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Sperm-associated antigen 7

Gene

SPAG7

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

GO - Molecular functionⁱ

nucleic acid binding Source: InterPro

View the complete GO annotation on QuickGO ...

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Sperm-associated antigen 7
Gene namesⁱ	Name:SPAG7
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 17

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000091640.7
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:11216 SPAG7
MIMⁱ	610056 gene
neXtProtⁱ	NX_O75391

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Organism-specific databases

Open Targets More...OpenTargetsⁱ	ENSG00000091640
PharmGKBⁱ	PA36052

Polymorphism and mutation databases

BioMutaⁱ	SPAG7

BioMutaⁱ

SPAG7

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources
ChainⁱPRO_0000072097	2 – 227	Sperm-associated antigen 7Add BLAST		226

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylalanineCombined sources	1
Modified residueⁱ	114	PhosphoserineCombined sources	1
Modified residueⁱ	158	PhosphoserineCombined sources	1
Modified residueⁱ	202	PhosphoserineCombined sources	1

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	O75391
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	O75391
PaxDbⁱ	O75391
PeptideAtlas More...PeptideAtlasⁱ	O75391
PRIDEⁱ	O75391
ProteomicsDBⁱ	49964

PTM databases

iPTMnetⁱ	O75391
PhosphoSitePlusⁱ	O75391

Expressionⁱ

Tissue specificityⁱ

Detected in fetal brain.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000091640 Expressed in 232 organ(s), highest expression level in muscle of leg
CleanExⁱ	HS_SPAG7
ExpressionAtlasⁱ	O75391 baseline and differential
Genevisibleⁱ	O75391 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA024032 HPA052394

HPAⁱ

HPA024032
HPA052394

Interactionⁱ

Protein-protein interaction databases

BioGridⁱ	114924, 10 interactors
IntActⁱ	O75391, 4 interactors
STRINGⁱ	9606.ENSP00000206020

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	45 – 61	Combined sources	17
Beta strandⁱ	67 – 69	Combined sources	3
Helixⁱ	77 – 88	Combined sources	12
Beta strandⁱ	91 – 95	Combined sources	5
Beta strandⁱ	97 – 100	Combined sources	4
Beta strandⁱ	103 – 107	Combined sources	5
Helixⁱ	115 – 123	Combined sources	9

Show more details

3D structure databases

ProteinModelPortalⁱ	O75391
SMRⁱ	O75391
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	O75391

EvolutionaryTraceⁱ

O75391

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	46 – 109	R3HPROSITE-ProRule annotationAdd BLAST		64

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	35 – 51	Nuclear localization signalSequence analysisAdd BLAST		17
Motifⁱ	122 – 139	Nuclear localization signalSequence analysisAdd BLAST		18

Phylogenomic databases

eggNOGⁱ	ENOG410IG7F Eukaryota ENOG4111H0W LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000001520
HOGENOMⁱ	HOG000234363
HOVERGENⁱ	HBG066267
InParanoidⁱ	O75391
OMAⁱ	HRSVIHE
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0QPO
PhylomeDBⁱ	O75391
TreeFamⁱ	TF323631

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd02636 R3H_sperm-antigen, 1 hit
Gene3Dⁱ	3.30.1370.50, 1 hit
InterProⁱ	View protein in InterPro IPR001374 R3H_dom IPR036867 R3H_dom_sf IPR034068 R3H_sperm-antigen IPR017330 SPAG7
PANTHERⁱ	PTHR13498 PTHR13498, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01424 R3H, 1 hit
PIRSFⁱ	PIRSF037943 Sperm-assoc_antigen_PAG7, 1 hit
SMARTⁱ	View protein in SMART SM00393 R3H, 1 hit
SUPFAMⁱ	SSF82708 SSF82708, 1 hit
PROSITEⁱ	View protein in PROSITE PS51061 R3H, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

O75391-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MADLLGSILS SMEKPPSLGD QETRRKAREQ AARLKKLQEQ EKQQKVEFRK 
        60         70         80         90        100
RMEKEVSDFI QDSGQIKKKF QPMNKIERSI LHDVVEVAGL TSFSFGEDDD 
       110        120        130        140        150
CRYVMIFKKE FAPSDEELDS YRRGEEWDPQ KAEEKRKLKE LAQRQEEEAA 
       160        170        180        190        200
QQGPVVVSPA SDYKDKYSHL IGKGAAKDAA HMLQANKTYG CVPVANKRDT 
       210        220 
RSIEEAMNEI RAKKRLRQSG EELPPTS

Length:227

Mass (Da):26,034

Last modified:March 29, 2005 - v2

Checksum:ⁱ429566BE9B276EE4

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

I3L0X5	I3L0X5_HUMAN	Sperm-associated antigen 7 Sperm-associated antigen 7	SPAG7	176	Annotation score:
I3L4C3	I3L4C3_HUMAN	Sperm-associated antigen 7 Sperm-associated antigen 7	SPAG7	194	Annotation score:
I3L0Q5	I3L0Q5_HUMAN	Sperm-associated antigen 7 Sperm-associated antigen 7	SPAG7	87	Annotation score:

Sequence cautionⁱ

The sequence AAC39888 differs from that shown. Reason: Frameshift at position 227.Curated

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF047437 mRNA Translation: AAC39888.1 Frameshift. BC011934 mRNA Translation: AAH11934.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS42240.1
NCBI Reference Sequences More...RefSeqⁱ	NP_004881.2, NM_004890.2
UniGeneⁱ	Hs.90436

Genome annotation databases

Ensemblⁱ	ENST00000206020; ENSP00000206020; ENSG00000091640
GeneIDⁱ	9552
KEGGⁱ	hsa:9552
UCSC genome browser More...UCSCⁱ	uc002gae.4 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O75391	Sperm-associated antigen 7		MACFA		227	UniRef100_O75391
Sperm-associated antigen 7		PONAB		227
Sperm-associated antigen 7		MACMU		227
Sperm-associated antigen 7		COLAP		227
Sperm-associated antigen 7		CERAT		227
+10

Protein	Similar proteins		Species	Score	Length	Source
O75391	Sperm-associated antigen 7		MOUSE		227	UniRef90_O75391
Sperm-associated antigen 7		MACFA		227
Sperm-associated antigen 7		PONAB		227
Sperm-associated antigen 7		MACMU		227
Sperm-associated antigen 7		COLAP		227
+92

Protein	Similar proteins		Species	Score	Length	Source
O75391	Sperm-associated antigen 7		MOUSE		227	UniRef50_O75391
Sperm-associated antigen 7 homolog		DANRE		230
Sperm-associated antigen 7		MACFA		227
Sperm-associated antigen 7		PONAB		227
Sperm-associated antigen 7		MACMU		227
+178

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF047437 mRNA Translation: AAC39888.1 Frameshift. BC011934 mRNA Translation: AAH11934.1
CCDSⁱ	CCDS42240.1
RefSeqⁱ	NP_004881.2, NM_004890.2
UniGeneⁱ	Hs.90436

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2CPM	NMR	-	A	44-124	[»]
ProteinModelPortalⁱ	O75391
SMRⁱ	O75391
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	114924, 10 interactors
IntActⁱ	O75391, 4 interactors
STRINGⁱ	9606.ENSP00000206020

PTM databases

iPTMnetⁱ	O75391
PhosphoSitePlusⁱ	O75391

Polymorphism and mutation databases

BioMutaⁱ	SPAG7

BioMutaⁱ

SPAG7

Proteomic databases

EPDⁱ	O75391
MaxQBⁱ	O75391
PaxDbⁱ	O75391
PeptideAtlasⁱ	O75391
PRIDEⁱ	O75391
ProteomicsDBⁱ	49964

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000206020; ENSP00000206020; ENSG00000091640
GeneIDⁱ	9552
KEGGⁱ	hsa:9552
UCSCⁱ	uc002gae.4 human

Organism-specific databases

CTDⁱ	9552
EuPathDBⁱ	HostDB:ENSG00000091640.7
GeneCardsⁱ	SPAG7
HGNCⁱ	HGNC:11216 SPAG7
HPAⁱ	HPA024032 HPA052394
MIMⁱ	610056 gene
neXtProtⁱ	NX_O75391
OpenTargetsⁱ	ENSG00000091640
PharmGKBⁱ	PA36052
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IG7F Eukaryota ENOG4111H0W LUCA
GeneTreeⁱ	ENSGT00390000001520
HOGENOMⁱ	HOG000234363
HOVERGENⁱ	HBG066267
InParanoidⁱ	O75391
OMAⁱ	HRSVIHE
OrthoDBⁱ	EOG091G0QPO
PhylomeDBⁱ	O75391
TreeFamⁱ	TF323631

Miscellaneous databases

ChiTaRSⁱ	SPAG7 human
EvolutionaryTraceⁱ	O75391
GeneWikiⁱ	SPAG7
GenomeRNAiⁱ	9552
Protein Ontology More...PROⁱ	PR:O75391
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000091640 Expressed in 232 organ(s), highest expression level in muscle of leg
CleanExⁱ	HS_SPAG7
ExpressionAtlasⁱ	O75391 baseline and differential
Genevisibleⁱ	O75391 HS

Family and domain databases

CDDⁱ	cd02636 R3H_sperm-antigen, 1 hit
Gene3Dⁱ	3.30.1370.50, 1 hit
InterProⁱ	View protein in InterPro IPR001374 R3H_dom IPR036867 R3H_dom_sf IPR034068 R3H_sperm-antigen IPR017330 SPAG7
PANTHERⁱ	PTHR13498 PTHR13498, 1 hit
Pfamⁱ	View protein in Pfam PF01424 R3H, 1 hit
PIRSFⁱ	PIRSF037943 Sperm-assoc_antigen_PAG7, 1 hit
SMARTⁱ	View protein in SMART SM00393 R3H, 1 hit
SUPFAMⁱ	SSF82708 SSF82708, 1 hit
PROSITEⁱ	View protein in PROSITE PS51061 R3H, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	SPAG7_HUMAN
Accessionⁱ	O75391Primary (citable) accession number: O75391 Secondary accession number(s): Q96EU5
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 29, 2005
	Last sequence update:	March 29, 2005
	Last modified:	November 7, 2018
	This is version 139 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome 17
Human chromosome 17: entries, gene names and cross-references to MIM
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O75391 (SPAG7_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Sperm-associated antigen 7

SPAG7

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Motif

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ