Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O75386 (TULP3_HUMAN)

Entry version 160 (12 Aug 2020)
Sequence version 2 (06 Feb 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tubby-related protein 3

Gene

TULP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negative regulator of the Shh signaling transduction pathway: recruited to primary cilia via association with the IFT complex A (IFT-A) and is required for recruitment of G protein-coupled receptor GPR161 to cilia, a promoter of PKA-dependent basal repression machinery in Shh signaling. Binds to phosphorylated inositide (phosphoinositide) lipids. Both IFT-A- and phosphoinositide-binding properties are required to regulate ciliary G protein-coupled receptor trafficking. Not involved in ciliogenesis. During adipogenesis, regulates ciliary trafficking of FFAR4 in preadipocytes.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O75386

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5610787, Hedgehog 'off' state

SIGNOR Signaling Network Open Resource

More...SIGNORi		O75386

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tubby-related protein 3Curated
Alternative name(s):
Tubby-like protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TULP3Imported
Synonyms:TUBL3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000078246.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:12425, TULP3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604730, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75386

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cilium, Cytoplasm, Membrane, Nucleus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi24 – 34RQAKLDYQRLL → AQAAADYAALA in mut12; abolishes association with the IFT complex A (IFT-A) without affecting phosphoinositide binding. Impaired localization to cilia. 1 PublicationAdd BLAST11
Mutagenesisi268 – 270KLR → ALA in TULP3KR; abolishes phosphoinositide binding and impairs localization to cilia. Still associates with the IFT complex A (IFT-A). 1 Publication3

Organism-specific databases

DisGeNET

More...DisGeNETi		7289

Open Targets

More...OpenTargetsi		ENSG00000078246

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37087

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75386, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TULP3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001864701 – 442Tubby-related protein 3Add BLAST442

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O75386

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O75386

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75386

MaxQB - The MaxQuant DataBase

More...MaxQBi		O75386

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75386

PeptideAtlas

More...PeptideAtlasi		O75386

PRoteomics IDEntifications database

More...PRIDEi		O75386

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		30981
49959 [O75386-1]
6762

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75386

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75386

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high levels in testis, ovaries, thyroid, and spinal chord.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000078246, Expressed in secondary oocyte and 243 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75386, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75386, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000078246, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associates with the IFT complex A (IFT-A).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113140, 66 interactors

Protein interaction database and analysis system

More...IntActi		O75386, 108 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000380321

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75386, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O75386

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni23 – 68Required for association with the IFT complex A (IFT-A)Add BLAST46

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TUB family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2502, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158155

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_1570112_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75386

Identification of Orthologs from Complete Genome Data

More...OMAi		HNDVILH

Database of Orthologous Groups

More...OrthoDBi		1445357at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75386

TreeFam database of animal gene trees

More...TreeFami		TF314076

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.20.90.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR025659, Tubby-like_C
IPR000007, Tubby_C
IPR018066, Tubby_C_CS
IPR005398, Tubby_N

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01167, Tub, 1 hit
PF16322, Tub_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01573, SUPERTUBBY
PR01574, TUBBYPROTEIN

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54518, SSF54518, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01200, TUB_1, 1 hit
PS01201, TUB_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75386-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEASRCRLSP SGDSVFHEEM MKMRQAKLDY QRLLLEKRQR KKRLEPFMVQ 
        60         70         80         90        100
PNPEARLRRA KPRASDEQTP LVNCHTPHSN VILHGIDGPA AVLKPDEVHA 
       110        120        130        140        150
PSVSSSVVEE DAENTVDTAS KPGLQERLQK HDISESVNFD EETDGISQSA 
       160        170        180        190        200
CLERPNSASS QNSTDTGTSG SATAAQPADN LLGDIDDLED FVYSPAPQGV 
       210        220        230        240        250
TVRCRIIRDK RGMDRGLFPT YYMYLEKEEN QKIFLLAARK RKKSKTANYL 
       260        270        280        290        300
ISIDPVDLSR EGESYVGKLR SNLMGTKFTV YDRGICPMKG RGLVGAAHTR 
       310        320        330        340        350
QELAAISYET NVLGFKGPRK MSVIIPGMTL NHKQIPYQPQ NNHDSLLSRW 
       360        370        380        390        400
QNRTMENLVE LHNKAPVWNS DTQSYVLNFR GRVTQASVKN FQIVHKNDPD 
       410        420        430        440 
YIVMQFGRVA DDVFTLDYNY PLCAVQAFGI GLSSFDSKLA CE
Length:442
Mass (Da):49,642
Last modified:February 6, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i13DBC83305BFAC1D
GO
Isoform 2 (identifier: O75386-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-442: SKLACE → KCIQTLRMQELCELHRQHHSAASLVHRTVCQRWVGHPWRLLPQTSLLWTDLSPPPVVPAPHQISM

Show »
Length:501
Mass (Da):56,545
Checksum:i15F3B7C6A80F3ABA
GO
Isoform 3 (identifier: O75386-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: Missing.
     165-189: DTGTSGSATAAQPADNLLGDIDDLE → FSSFCQKTEDTGYRHFRFCYCRPTS
     190-442: Missing.

Show »
Length:170
Mass (Da):19,273
Checksum:i833707F24020C56E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H7B9F5H7B9_HUMAN
Tubby-related protein 3
TULP3
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFU8H0YFU8_HUMAN
Tubby-related protein 3
TULP3
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YG12H0YG12_HUMAN
Tubby-related protein 3
TULP3
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GWL5F5GWL5_HUMAN
Tubby-related protein 3
TULP3
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti168 – 181TSGSA…PADNL → IPVLLLPPNQLITF in AAC95431 (PubMed:9828123).CuratedAdd BLAST14
Sequence conflicti187D → Y in AAH32587 (PubMed:15489334).Curated1
Sequence conflicti193 – 194YS → LV in AAC95431 (PubMed:9828123).Curated2
Sequence conflicti219 – 226PTYYMYLE → SHLLYVLG in AAC95431 (PubMed:9828123).Curated8
Sequence conflicti393I → L in AAC95431 (PubMed:9828123).Curated1
Sequence conflicti429 – 431GIG → AIS in AAC95431 (PubMed:9828123).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0557611 – 19Missing in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_055762165 – 189DTGTS…IDDLE → FSSFCQKTEDTGYRHFRFCY CRPTS in isoform 3. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_055763190 – 442Missing in isoform 3. 1 PublicationAdd BLAST253
Alternative sequenceiVSP_054752437 – 442SKLACE → KCIQTLRMQELCELHRQHHS AASLVHRTVCQRWVGHPWRL LPQTSLLWTDLSPPPVVPAP HQISM in isoform 2. Curated6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF045583 mRNA Translation: AAC95431.1
AK024246 mRNA Translation: BAG51279.1
AK299990 mRNA Translation: BAH13188.1
AC005911 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88876.1
CH471116 Genomic DNA Translation: EAW88877.1
CH471116 Genomic DNA Translation: EAW88878.1
BC032587 mRNA Translation: AAH32587.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS53737.1 [O75386-2]
CCDS8519.1 [O75386-1]

NCBI Reference Sequences

More...RefSeqi		NP_001153880.1, NM_001160408.1 [O75386-2]
NP_003315.2, NM_003324.4 [O75386-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000397132; ENSP00000380321; ENSG00000078246 [O75386-2]
ENST00000448120; ENSP00000410051; ENSG00000078246 [O75386-1]
ENST00000540184; ENSP00000444110; ENSG00000078246 [O75386-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7289

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7289

UCSC genome browser

More...UCSCi		uc001qlj.3, human [O75386-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF045583 mRNA Translation: AAC95431.1
AK024246 mRNA Translation: BAG51279.1
AK299990 mRNA Translation: BAH13188.1
AC005911 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88876.1
CH471116 Genomic DNA Translation: EAW88877.1
CH471116 Genomic DNA Translation: EAW88878.1
BC032587 mRNA Translation: AAH32587.1
CCDSiCCDS53737.1 [O75386-2]
CCDS8519.1 [O75386-1]
RefSeqiNP_001153880.1, NM_001160408.1 [O75386-2]
NP_003315.2, NM_003324.4 [O75386-1]

3D structure databases

SMRiO75386
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi113140, 66 interactors
IntActiO75386, 108 interactors
STRINGi9606.ENSP00000380321

PTM databases

iPTMnetiO75386
PhosphoSitePlusiO75386

Polymorphism and mutation databases

BioMutaiTULP3

Proteomic databases

EPDiO75386
jPOSTiO75386
MassIVEiO75386
MaxQBiO75386
PaxDbiO75386
PeptideAtlasiO75386
PRIDEiO75386
ProteomicsDBi30981
49959 [O75386-1]
6762

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		10458, 246 antibodies

The DNASU plasmid repository

More...DNASUi		7289

Genome annotation databases

EnsembliENST00000397132; ENSP00000380321; ENSG00000078246 [O75386-2]
ENST00000448120; ENSP00000410051; ENSG00000078246 [O75386-1]
ENST00000540184; ENSP00000444110; ENSG00000078246 [O75386-3]
GeneIDi7289
KEGGihsa:7289
UCSCiuc001qlj.3, human [O75386-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7289
DisGeNETi7289
EuPathDBiHostDB:ENSG00000078246.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		TULP3
HGNCiHGNC:12425, TULP3
HPAiENSG00000078246, Low tissue specificity
MIMi604730, gene
neXtProtiNX_O75386
OpenTargetsiENSG00000078246
PharmGKBiPA37087

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2502, Eukaryota
GeneTreeiENSGT00940000158155
HOGENOMiCLU_1570112_0_0_1
InParanoidiO75386
OMAiHNDVILH
OrthoDBi1445357at2759
PhylomeDBiO75386
TreeFamiTF314076

Enzyme and pathway databases

PathwayCommonsiO75386
ReactomeiR-HSA-5610787, Hedgehog 'off' state
SIGNORiO75386

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7289, 5 hits in 901 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TULP3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7289
PharosiO75386, Tbio

Protein Ontology

More...PROi		PR:O75386
RNActiO75386, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000078246, Expressed in secondary oocyte and 243 other tissues
ExpressionAtlasiO75386, baseline and differential
GenevisibleiO75386, HS

Family and domain databases

Gene3Di3.20.90.10, 1 hit
InterProiView protein in InterPro
IPR025659, Tubby-like_C
IPR000007, Tubby_C
IPR018066, Tubby_C_CS
IPR005398, Tubby_N
PfamiView protein in Pfam
PF01167, Tub, 1 hit
PF16322, Tub_N, 1 hit
PRINTSiPR01573, SUPERTUBBY
PR01574, TUBBYPROTEIN
SUPFAMiSSF54518, SSF54518, 1 hit
PROSITEiView protein in PROSITE
PS01200, TUB_1, 1 hit
PS01201, TUB_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTULP3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75386
Secondary accession number(s): B3KNB7
, B7Z6A2, D3DUQ4, F8WBZ9, Q8N5B0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 6, 2007
Last modified: August 12, 2020
This is version 160 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again