Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O75363 (BCAS1_HUMAN)

Protein

Breast carcinoma-amplified sequence 1

Gene

BCAS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for myelination.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Breast carcinoma-amplified sequence 1
Alternative name(s):
Amplified and overexpressed in breast cancer
Novel amplified in breast cancer 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BCAS1
Synonyms:AIBC1, NABC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000064787.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:974 BCAS1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602968 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75363

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		8537

Open Targets

More...OpenTargetsi		ENSG00000064787

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25284

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BCAS1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000648591 – 584Breast carcinoma-amplified sequence 1Add BLAST584

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei124PhosphoserineBy similarity1
Modified residuei192PhosphoserineBy similarity1
Modified residuei314PhosphoserineBy similarity1
Modified residuei381PhosphoserineBy similarity1
Modified residuei399PhosphoserineBy similarity1
Modified residuei480PhosphothreonineBy similarity1
Modified residuei552PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O75363

MaxQB - The MaxQuant DataBase

More...MaxQBi		O75363

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75363

PeptideAtlas

More...PeptideAtlasi		O75363

PRoteomics IDEntifications database

More...PRIDEi		O75363

ProteomicsDB human proteome resource

More...ProteomicsDBi		49926
49927 [O75363-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75363

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75363

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the brain and, more specifically, in oligodendrocytes (at protein level). Expressed in the prostate, and at lower levels in testis, intestine and colon. Overexpressed in most breast cancer cell lines and down-regulated in some colorectal tumors.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000064787 Expressed in 183 organ(s), highest expression level in C1 segment of cervical spinal cord

CleanEx database of gene expression profiles

More...CleanExi		HS_BCAS1

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75363 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75363 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB033558
HPA051816
HPA054745

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (PubMed:14567997). Interacts with DYNLL1 and DYNLL2 (By similarity).By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		114107, 3 interactors

Protein interaction database and analysis system

More...IntActi		O75363, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000379290

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		O75363

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O75363

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni565 – 584Interacts with DYNLL1 AND DYNLL2By similarityAdd BLAST20

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IJ5W Eukaryota
ENOG41119UT LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000003167

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000232037

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG082347

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75363

Identification of Orthologs from Complete Genome Data

More...OMAi		TQGAAKN

Database of Orthologous Groups

More...OrthoDBi		1009953at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75363

TreeFam database of animal gene trees

More...TreeFami		TF335555

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR026115 NABC1

The PANTHER Classification System

More...PANTHERi		PTHR15016 PTHR15016, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75363-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNQMSVPQR VEDQENEPEA ETYQDNASAL NGVPVVVSTH TVQHLEEVDL 
        60         70         80         90        100
GISVKTDNVA TSSPETTEIS AVADANGKNL GKEAKPEAPA AKSRFFLMLS 
       110        120        130        140        150
RPVPGRTGDQ AADSSLGSVK LDVSSNKAPA NKDPSESWTL PVAAGPGQDT 
       160        170        180        190        200
DKTPGHAPAQ DKVLSAARDP TLLPPETGGA GGEAPSKPKD SSFFDKFFKL 
       210        220        230        240        250
DKGQEKVPGD SQQEAKRAEH QDKVDEVPGL SGQSDDVPAG KDIVDGKEKE 
       260        270        280        290        300
GQELGTADCS VPGDPEGLET AKDDSQAAAI AENNNSIMSF FKTLVSPNKA 
       310        320        330        340        350
ETKKDPEDTG AEKSPTTSAD LKSDKANFTS QETQGAGKNS KGCNPSGHTQ 
       360        370        380        390        400
SVTTPEPAKE GTKEKSGPTS LPLGKLFWKK SVKEDSVPTG AEENVVCESP 
       410        420        430        440        450
VEIIKSKEVE SALQTVDLNE GDAAPEPTEA KLKREESKPR TSLMAFLRQM 
       460        470        480        490        500
SVKGDGGITH SEEINGKDSS CQTSDSTEKT ITPPEPEPTG APQKGKEGSS 
       510        520        530        540        550
KDKKSAAEMN KQKSNKQEAK EPAQCTEQAT VDTNSLQNGD KLQKRPEKRQ 
       560        570        580 
QSLGGFFKGL GPKRMLDAQV QTDPVSIGPV GKSK
Length:584
Mass (Da):61,709
Last modified:June 13, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i22921C0B37129944
GO
Isoform 2 (identifier: O75363-2) [UniParc]FASTAAdd to basket
Also known as: 5B

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: T → TASKAESVCDGQAGQKTSEIQARGTKKKHLDSPRLGLAFRKFFRHK
     381-394: Missing.
     451-472: Missing.
     584-584: K → KYTGKCVFSHVKKKWPFQEWSY

Show »
Length:614
Mass (Da):65,663
Checksum:iDA05CD7CEB86C170
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3XAF7G3XAF7_HUMAN
Breast carcinoma amplified sequence...
BCAS1 hCG_37358
506Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1E7H7C1E7_HUMAN
Breast carcinoma-amplified sequence...
BCAS1
247Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y542H0Y542_HUMAN
Breast carcinoma-amplified sequence...
BCAS1
476Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti361G → D in CAH18437 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02667424Q → K. Corresponds to variant dbSNP:rs394732Ensembl.1
Natural variantiVAR_026675163V → A. Corresponds to variant dbSNP:rs158551Ensembl.1
Natural variantiVAR_024251255G → E. Corresponds to variant dbSNP:rs6022903Ensembl.1
Natural variantiVAR_050691472Q → H. Corresponds to variant dbSNP:rs35575210Ensembl.1
Natural variantiVAR_026676583S → P1 PublicationCorresponds to variant dbSNP:rs1055246Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018520309T → TASKAESVCDGQAGQKTSEI QARGTKKKHLDSPRLGLAFR KFFRHK in isoform 2. 2 Publications1
Alternative sequenceiVSP_018521381 – 394Missing in isoform 2. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_018522451 – 472Missing in isoform 2. 2 PublicationsAdd BLAST22
Alternative sequenceiVSP_018523584K → KYTGKCVFSHVKKKWPFQEW SY in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF041260 mRNA Translation: AAC39896.1
AC004501 Genomic DNA No translation available.
AC005220 Genomic DNA No translation available.
BC126346 mRNA Translation: AAI26347.1
AI904532 mRNA No translation available.
CR749643 mRNA Translation: CAH18437.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13444.1 [O75363-1]

NCBI Reference Sequences

More...RefSeqi		NP_003648.2, NM_003657.3 [O75363-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.400556

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000395961; ENSP00000379290; ENSG00000064787 [O75363-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8537

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8537

UCSC genome browser

More...UCSCi		uc002xws.3 human [O75363-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF041260 mRNA Translation: AAC39896.1
AC004501 Genomic DNA No translation available.
AC005220 Genomic DNA No translation available.
BC126346 mRNA Translation: AAI26347.1
AI904532 mRNA No translation available.
CR749643 mRNA Translation: CAH18437.1
CCDSiCCDS13444.1 [O75363-1]
RefSeqiNP_003648.2, NM_003657.3 [O75363-1]
UniGeneiHs.400556

3D structure databases

ProteinModelPortaliO75363
SMRiO75363
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114107, 3 interactors
IntActiO75363, 1 interactor
STRINGi9606.ENSP00000379290

PTM databases

iPTMnetiO75363
PhosphoSitePlusiO75363

Polymorphism and mutation databases

BioMutaiBCAS1

Proteomic databases

jPOSTiO75363
MaxQBiO75363
PaxDbiO75363
PeptideAtlasiO75363
PRIDEiO75363
ProteomicsDBi49926
49927 [O75363-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		8537
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000395961; ENSP00000379290; ENSG00000064787 [O75363-1]
GeneIDi8537
KEGGihsa:8537
UCSCiuc002xws.3 human [O75363-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8537
DisGeNETi8537
EuPathDBiHostDB:ENSG00000064787.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		BCAS1

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0015925
HGNCiHGNC:974 BCAS1
HPAiCAB033558
HPA051816
HPA054745
MIMi602968 gene
neXtProtiNX_O75363
OpenTargetsiENSG00000064787
PharmGKBiPA25284

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IJ5W Eukaryota
ENOG41119UT LUCA
GeneTreeiENSGT00390000003167
HOGENOMiHOG000232037
HOVERGENiHBG082347
InParanoidiO75363
OMAiTQGAAKN
OrthoDBi1009953at2759
PhylomeDBiO75363
TreeFamiTF335555

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		BCAS1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		BCAS1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8537

Protein Ontology

More...PROi		PR:O75363

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000064787 Expressed in 183 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_BCAS1
ExpressionAtlasiO75363 baseline and differential
GenevisibleiO75363 HS

Family and domain databases

InterProiView protein in InterPro
IPR026115 NABC1
PANTHERiPTHR15016 PTHR15016, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBCAS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75363
Secondary accession number(s): A0AVG5, Q68CZ3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: June 13, 2006
Last modified: January 16, 2019
This is version 139 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again