Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin-specific chaperone A

Gene

TBCA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Tubulin-folding protein; involved in the early step of the tubulin folding pathway.

GO - Molecular functioni

  • beta-tubulin binding Source: InterPro
  • chaperone binding Source: ProtInc
  • RNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionChaperone

Enzyme and pathway databases

ReactomeiR-HSA-389977 Post-chaperonin tubulin folding pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin-specific chaperone A
Alternative name(s):
TCP1-chaperonin cofactor A
Tubulin-folding cofactor A
Short name:
CFA
Gene namesi
Name:TBCA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000171530.13
HGNCiHGNC:11579 TBCA
MIMi610058 gene
neXtProtiNX_O75347

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi6902
OpenTargetsiENSG00000171530
PharmGKBiPA36343

Polymorphism and mutation databases

BioMutaiTBCA

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000800392 – 108Tubulin-specific chaperone AAdd BLAST107

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO75347
PaxDbiO75347
PeptideAtlasiO75347
PRIDEiO75347
ProteomicsDBi49916
TopDownProteomicsiO75347-1 [O75347-1]

2D gel databases

OGPiO75347
SWISS-2DPAGEiO75347

PTM databases

iPTMnetiO75347
PhosphoSitePlusiO75347

Expressioni

Gene expression databases

BgeeiENSG00000171530 Expressed in 113 organ(s), highest expression level in left adrenal gland
CleanExiHS_TBCA
ExpressionAtlasiO75347 baseline and differential
GenevisibleiO75347 HS

Organism-specific databases

HPAiHPA036487

Interactioni

Subunit structurei

Supercomplex made of cofactors A to E. Cofactors A and D function by capturing and stabilizing tubulin in a quasi-native conformation. Cofactor E binds to the cofactor D-tubulin complex; interaction with cofactor C then causes the release of tubulin polypeptides that are committed to the native state.

Binary interactionsi

WithEntry#Exp.IntActNotes
TERF2IPQ9NYB02EBI-2686341,EBI-750109

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112765, 14 interactors
IntActiO75347, 8 interactors
MINTiO75347
STRINGi9606.ENSP00000369736

Structurei

Secondary structure

1108
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO75347
SMRiO75347
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO75347

Family & Domainsi

Sequence similaritiesi

Belongs to the TBCA family.Curated

Phylogenomic databases

eggNOGiKOG3470 Eukaryota
ENOG4111Y9A LUCA
GeneTreeiENSGT00390000009710
HOGENOMiHOG000213817
HOVERGENiHBG004499
InParanoidiO75347
KOiK17292
PhylomeDBiO75347
TreeFamiTF313971

Family and domain databases

InterProiView protein in InterPro
IPR004226 TBCA
IPR036126 TBCA_sf
PANTHERiPTHR21500 PTHR21500, 1 hit
PfamiView protein in Pfam
PF02970 TBCA, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD010430 CofA_tubulin_bd, 1 hit
SUPFAMiSSF46988 SSF46988, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75347-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADPRVRQIK IKTGVVKRLV KEKVMYEKEA KQQEEKIEKM RAEDGENYDI
60 70 80 90 100
KKQAEILQES RMMIPDCQRR LEAAYLDLQR ILENEKDLEE AEEYKEARLV

LDSVKLEA
Length:108
Mass (Da):12,855
Last modified:January 23, 2007 - v3
Checksum:i222D8D945A5CD162
GO
Isoform 2 (identifier: O75347-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-108: ENEKDLEEAEEYKEARLVLDSVKLEA → VSKDFCVMFKFFFSIQYMESQKFKYLTLRTSWQYFLFTCPLYRYILK

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):15,792
Checksum:iA8BEFA6213E7F786
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RJD8E5RJD8_HUMAN
Tubulin-specific chaperone A
TBCA
119Annotation score:
E5RIW3E5RIW3_HUMAN
Tubulin-specific chaperone A
TBCA
84Annotation score:
E5RIX8E5RIX8_HUMAN
Tubulin-specific chaperone A
TBCA
79Annotation score:
E5RHG6E5RHG6_HUMAN
Tubulin-specific chaperone A
TBCA
131Annotation score:
E5RJM1E5RJM1_HUMAN
Tubulin-specific chaperone A
TBCA
26Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05635783 – 108ENEKD…VKLEA → VSKDFCVMFKFFFSIQYMES QKFKYLTLRTSWQYFLFTCP LYRYILK in isoform 2. 1 PublicationAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF038952 mRNA Translation: AAC39866.1
BT007354 mRNA Translation: AAP36018.1
AK300031 mRNA Translation: BAG61842.1
AC026717 Genomic DNA No translation available.
AC035147 Genomic DNA No translation available.
AC108482 Genomic DNA No translation available.
BC018210 mRNA Translation: AAH18210.1
CCDSiCCDS4040.1 [O75347-1]
CCDS75263.1 [O75347-2]
RefSeqiNP_001284667.1, NM_001297738.1 [O75347-2]
NP_004598.1, NM_004607.2 [O75347-1]
UniGeneiHs.291212
Hs.661401

Genome annotation databases

EnsembliENST00000306388; ENSP00000306362; ENSG00000171530 [O75347-2]
ENST00000380377; ENSP00000369736; ENSG00000171530 [O75347-1]
GeneIDi6902
KEGGihsa:6902
UCSCiuc003kfi.2 human [O75347-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF038952 mRNA Translation: AAC39866.1
BT007354 mRNA Translation: AAP36018.1
AK300031 mRNA Translation: BAG61842.1
AC026717 Genomic DNA No translation available.
AC035147 Genomic DNA No translation available.
AC108482 Genomic DNA No translation available.
BC018210 mRNA Translation: AAH18210.1
CCDSiCCDS4040.1 [O75347-1]
CCDS75263.1 [O75347-2]
RefSeqiNP_001284667.1, NM_001297738.1 [O75347-2]
NP_004598.1, NM_004607.2 [O75347-1]
UniGeneiHs.291212
Hs.661401

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1H7CX-ray1.80A2-108[»]
ProteinModelPortaliO75347
SMRiO75347
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112765, 14 interactors
IntActiO75347, 8 interactors
MINTiO75347
STRINGi9606.ENSP00000369736

PTM databases

iPTMnetiO75347
PhosphoSitePlusiO75347

Polymorphism and mutation databases

BioMutaiTBCA

2D gel databases

OGPiO75347
SWISS-2DPAGEiO75347

Proteomic databases

EPDiO75347
PaxDbiO75347
PeptideAtlasiO75347
PRIDEiO75347
ProteomicsDBi49916
TopDownProteomicsiO75347-1 [O75347-1]

Protocols and materials databases

DNASUi6902
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306388; ENSP00000306362; ENSG00000171530 [O75347-2]
ENST00000380377; ENSP00000369736; ENSG00000171530 [O75347-1]
GeneIDi6902
KEGGihsa:6902
UCSCiuc003kfi.2 human [O75347-1]

Organism-specific databases

CTDi6902
DisGeNETi6902
EuPathDBiHostDB:ENSG00000171530.13
GeneCardsiTBCA
HGNCiHGNC:11579 TBCA
HPAiHPA036487
MIMi610058 gene
neXtProtiNX_O75347
OpenTargetsiENSG00000171530
PharmGKBiPA36343
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3470 Eukaryota
ENOG4111Y9A LUCA
GeneTreeiENSGT00390000009710
HOGENOMiHOG000213817
HOVERGENiHBG004499
InParanoidiO75347
KOiK17292
PhylomeDBiO75347
TreeFamiTF313971

Enzyme and pathway databases

ReactomeiR-HSA-389977 Post-chaperonin tubulin folding pathway

Miscellaneous databases

ChiTaRSiTBCA human
EvolutionaryTraceiO75347
GeneWikiiTBCA
GenomeRNAii6902
PROiPR:O75347
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171530 Expressed in 113 organ(s), highest expression level in left adrenal gland
CleanExiHS_TBCA
ExpressionAtlasiO75347 baseline and differential
GenevisibleiO75347 HS

Family and domain databases

InterProiView protein in InterPro
IPR004226 TBCA
IPR036126 TBCA_sf
PANTHERiPTHR21500 PTHR21500, 1 hit
PfamiView protein in Pfam
PF02970 TBCA, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD010430 CofA_tubulin_bd, 1 hit
SUPFAMiSSF46988 SSF46988, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTBCA_HUMAN
AccessioniPrimary (citable) accession number: O75347
Secondary accession number(s): B4DT30
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 23, 2007
Last modified: September 12, 2018
This is version 154 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again