Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peroxisomal membrane protein 11A

Gene

PEX11A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in peroxisomal proliferation and may regulate peroxisomes division (PubMed:9792670). May mediate binding of coatomer proteins to the peroxisomal membrane (By similarity). Promotes membrane protrusion and elongation on the peroxisomal surface (PubMed:20826455).By similarity2 Publications

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processPeroxisome biogenesis

Enzyme and pathway databases

ReactomeiR-HSA-1989781 PPARA activates gene expression

Protein family/group databases

TCDBi1.A.101.1.2 the peroxisomal pore-forming pex11 (pex11) family

Names & Taxonomyi

Protein namesi
Recommended name:
Peroxisomal membrane protein 11A
Short name:
HsPEX11p
Alternative name(s):
28 kDa peroxisomal integral membrane protein
Short name:
PMP28
Peroxin-11A
Peroxisomal biogenesis factor 11A
Protein PEX11 homolog alpha
Short name:
PEX11-alpha
Gene namesi
Name:PEX11A
Synonyms:PEX11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000166821.8
HGNCiHGNC:8852 PEX11A
MIMi603866 gene
neXtProtiNX_O75192

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 83CytoplasmicSequence analysisAdd BLAST83
Transmembranei84 – 105HelicalSequence analysisAdd BLAST22
Topological domaini106 – 219LumenalSequence analysisAdd BLAST114
Transmembranei220 – 239HelicalSequence analysisAdd BLAST20
Topological domaini240 – 247CytoplasmicSequence analysis8

Keywords - Cellular componenti

Membrane, Peroxisome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi9N → D: No effect on peroxisomal location. 1 Publication1
Mutagenesisi243 – 245KLK → SLS: No effect on peroxisomal location. 1 Publication3

Organism-specific databases

DisGeNETi8800
OpenTargetsiENSG00000166821
PharmGKBiPA33194

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001059641 – 247Peroxisomal membrane protein 11AAdd BLAST247

Post-translational modificationi

Seems not to be N-glycosylated.

Proteomic databases

EPDiO75192
MaxQBiO75192
PaxDbiO75192
PeptideAtlasiO75192
PRIDEiO75192
ProteomicsDBi49864

PTM databases

iPTMnetiO75192
PhosphoSitePlusiO75192

Expressioni

Gene expression databases

BgeeiENSG00000166821 Expressed in 213 organ(s), highest expression level in parietal pleura
CleanExiHS_PEX11A
ExpressionAtlasiO75192 baseline and differential
GenevisibleiO75192 HS

Interactioni

Subunit structurei

Homodimer (PubMed:20826455). Heterodimer with PEX11G (PubMed:20826455). Probably interacts with COPB2 and COPA (By similarity). Interacts with PEX19 (PubMed:10704444). Interacts with FIS1 (PubMed:20826455).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114328, 6 interactors
IntActiO75192, 1 interactor
MINTiO75192
STRINGi9606.ENSP00000300056

Structurei

3D structure databases

ProteinModelPortaliO75192
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni220 – 239Required for homodimerization, interaction with PEX11G, and peroxisomal localization1 PublicationAdd BLAST20

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi159 – 182Gly-richAdd BLAST24

Sequence similaritiesi

Belongs to the peroxin-11 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4186 Eukaryota
ENOG4111NS6 LUCA
GeneTreeiENSGT00390000014273
HOGENOMiHOG000251589
HOVERGENiHBG053771
InParanoidiO75192
KOiK13351
OMAiNLCDILN
OrthoDBiEOG091G0H6Y
PhylomeDBiO75192
TreeFamiTF325704

Family and domain databases

InterProiView protein in InterPro
IPR008733 PEX11
PfamiView protein in Pfam
PF05648 PEX11, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75192-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAFTRFTNQ TQGRDRLFRA TQYTCMLLRY LLEPKAGKEK VVMKLKKLES
60 70 80 90 100
SVSTGRKWFR LGNVVHAIQA TEQSIHATDL VPRLCLTLAN LNRVIYFICD
110 120 130 140 150
TILWVRSVGL TSGINKEKWR TRAAHHYYYS LLLSLVRDLY EISLQMKRVT
160 170 180 190 200
CDRAKKEKSA SQDPLWFSVA EEETEWLQSF LLLLFRSLKQ HPPLLLDTVK
210 220 230 240
NLCDILNPLD QLGIYKSNPG IIGLGGLVSS IAGMITVAYP QMKLKTR
Length:247
Mass (Da):28,353
Last modified:November 1, 1998 - v1
Checksum:iD904EC715271FF87
GO
Isoform 2 (identifier: O75192-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-89: WFRLGNVVHAIQATEQSIHATDLVPRLCLTLA → S

Show »
Length:216
Mass (Da):24,884
Checksum:i3BACCDB9F688112B
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YMC7H0YMC7_HUMAN
Peroxisomal membrane protein 11A
PEX11A
64Annotation score:
H0YN61H0YN61_HUMAN
Peroxisomal membrane protein 11A
PEX11A
32Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05475358 – 89WFRLG…CLTLA → S in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015594 mRNA Translation: BAA32533.1
AF093668 mRNA Translation: AAC78658.1
CR542046 mRNA Translation: CAG46843.1
CR542075 mRNA Translation: CAG46872.1
AK300978 mRNA Translation: BAG62600.1
AC013787 Genomic DNA No translation available.
BC009697 mRNA Translation: AAH09697.1
CCDSiCCDS10354.1 [O75192-1]
CCDS61751.1 [O75192-2]
RefSeqiNP_001258501.1, NM_001271572.1 [O75192-2]
NP_003838.1, NM_003847.2 [O75192-1]
UniGeneiHs.31034

Genome annotation databases

EnsembliENST00000300056; ENSP00000300056; ENSG00000166821 [O75192-1]
ENST00000561257; ENSP00000453492; ENSG00000166821 [O75192-2]
GeneIDi8800
KEGGihsa:8800
UCSCiuc002boi.5 human [O75192-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015594 mRNA Translation: BAA32533.1
AF093668 mRNA Translation: AAC78658.1
CR542046 mRNA Translation: CAG46843.1
CR542075 mRNA Translation: CAG46872.1
AK300978 mRNA Translation: BAG62600.1
AC013787 Genomic DNA No translation available.
BC009697 mRNA Translation: AAH09697.1
CCDSiCCDS10354.1 [O75192-1]
CCDS61751.1 [O75192-2]
RefSeqiNP_001258501.1, NM_001271572.1 [O75192-2]
NP_003838.1, NM_003847.2 [O75192-1]
UniGeneiHs.31034

3D structure databases

ProteinModelPortaliO75192
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114328, 6 interactors
IntActiO75192, 1 interactor
MINTiO75192
STRINGi9606.ENSP00000300056

Protein family/group databases

TCDBi1.A.101.1.2 the peroxisomal pore-forming pex11 (pex11) family

PTM databases

iPTMnetiO75192
PhosphoSitePlusiO75192

Proteomic databases

EPDiO75192
MaxQBiO75192
PaxDbiO75192
PeptideAtlasiO75192
PRIDEiO75192
ProteomicsDBi49864

Protocols and materials databases

DNASUi8800
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300056; ENSP00000300056; ENSG00000166821 [O75192-1]
ENST00000561257; ENSP00000453492; ENSG00000166821 [O75192-2]
GeneIDi8800
KEGGihsa:8800
UCSCiuc002boi.5 human [O75192-1]

Organism-specific databases

CTDi8800
DisGeNETi8800
EuPathDBiHostDB:ENSG00000166821.8
GeneCardsiPEX11A
HGNCiHGNC:8852 PEX11A
MIMi603866 gene
neXtProtiNX_O75192
OpenTargetsiENSG00000166821
PharmGKBiPA33194
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4186 Eukaryota
ENOG4111NS6 LUCA
GeneTreeiENSGT00390000014273
HOGENOMiHOG000251589
HOVERGENiHBG053771
InParanoidiO75192
KOiK13351
OMAiNLCDILN
OrthoDBiEOG091G0H6Y
PhylomeDBiO75192
TreeFamiTF325704

Enzyme and pathway databases

ReactomeiR-HSA-1989781 PPARA activates gene expression

Miscellaneous databases

GeneWikiiPEX11A
GenomeRNAii8800
PROiPR:O75192
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000166821 Expressed in 213 organ(s), highest expression level in parietal pleura
CleanExiHS_PEX11A
ExpressionAtlasiO75192 baseline and differential
GenevisibleiO75192 HS

Family and domain databases

InterProiView protein in InterPro
IPR008733 PEX11
PfamiView protein in Pfam
PF05648 PEX11, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPX11A_HUMAN
AccessioniPrimary (citable) accession number: O75192
Secondary accession number(s): B4DV88
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: November 1, 1998
Last modified: September 12, 2018
This is version 130 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again