Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peroxisomal membrane protein 11A

Gene

PEX11A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in peroxisomal proliferation and may regulate peroxisomes division (PubMed:9792670). May mediate binding of coatomer proteins to the peroxisomal membrane (By similarity). Promotes membrane protrusion and elongation on the peroxisomal surface (PubMed:20826455).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processPeroxisome biogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1989781 PPARA activates gene expression

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.101.1.2 the peroxisomal pore-forming pex11 (pex11) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peroxisomal membrane protein 11A
Short name:
HsPEX11p
Alternative name(s):
28 kDa peroxisomal integral membrane protein
Short name:
PMP28
Peroxin-11A
Peroxisomal biogenesis factor 11A
Protein PEX11 homolog alpha
Short name:
PEX11-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PEX11A
Synonyms:PEX11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000166821.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8852 PEX11A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603866 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75192

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 83CytoplasmicSequence analysisAdd BLAST83
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei84 – 105HelicalSequence analysisAdd BLAST22
Topological domaini106 – 219LumenalSequence analysisAdd BLAST114
Transmembranei220 – 239HelicalSequence analysisAdd BLAST20
Topological domaini240 – 247CytoplasmicSequence analysis8

Keywords - Cellular componenti

Membrane, Peroxisome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi9N → D: No effect on peroxisomal location. 1 Publication1
Mutagenesisi243 – 245KLK → SLS: No effect on peroxisomal location. 1 Publication3

Organism-specific databases

DisGeNET

More...
DisGeNETi
8800

Open Targets

More...
OpenTargetsi
ENSG00000166821

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33194

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PEX11A

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001059641 – 247Peroxisomal membrane protein 11AAdd BLAST247

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Seems not to be N-glycosylated.

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75192

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75192

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75192

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75192

PeptideAtlas

More...
PeptideAtlasi
O75192

PRoteomics IDEntifications database

More...
PRIDEi
O75192

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49864

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75192

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75192

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000166821 Expressed in 213 organ(s), highest expression level in parietal pleura

CleanEx database of gene expression profiles

More...
CleanExi
HS_PEX11A

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75192 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75192 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (PubMed:20826455). Heterodimer with PEX11G (PubMed:20826455). Probably interacts with COPB2 and COPA (By similarity). Interacts with PEX19 (PubMed:10704444). Interacts with FIS1 (PubMed:20826455).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114328, 6 interactors

Protein interaction database and analysis system

More...
IntActi
O75192, 1 interactor

Molecular INTeraction database

More...
MINTi
O75192

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000300056

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75192

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni220 – 239Required for homodimerization, interaction with PEX11G, and peroxisomal localization1 PublicationAdd BLAST20

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi159 – 182Gly-richAdd BLAST24

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peroxin-11 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4186 Eukaryota
ENOG4111NS6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014273

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000251589

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053771

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75192

KEGG Orthology (KO)

More...
KOi
K13351

Identification of Orthologs from Complete Genome Data

More...
OMAi
TQYACAL

Database of Orthologous Groups

More...
OrthoDBi
1394894at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75192

TreeFam database of animal gene trees

More...
TreeFami
TF325704

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008733 PEX11

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05648 PEX11, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75192-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAFTRFTNQ TQGRDRLFRA TQYTCMLLRY LLEPKAGKEK VVMKLKKLES
60 70 80 90 100
SVSTGRKWFR LGNVVHAIQA TEQSIHATDL VPRLCLTLAN LNRVIYFICD
110 120 130 140 150
TILWVRSVGL TSGINKEKWR TRAAHHYYYS LLLSLVRDLY EISLQMKRVT
160 170 180 190 200
CDRAKKEKSA SQDPLWFSVA EEETEWLQSF LLLLFRSLKQ HPPLLLDTVK
210 220 230 240
NLCDILNPLD QLGIYKSNPG IIGLGGLVSS IAGMITVAYP QMKLKTR
Length:247
Mass (Da):28,353
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD904EC715271FF87
GO
Isoform 2 (identifier: O75192-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-89: WFRLGNVVHAIQATEQSIHATDLVPRLCLTLA → S

Show »
Length:216
Mass (Da):24,884
Checksum:i3BACCDB9F688112B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YMC7H0YMC7_HUMAN
Peroxisomal membrane protein 11A
PEX11A
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YN61H0YN61_HUMAN
Peroxisomal membrane protein 11A
PEX11A
32Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05475358 – 89WFRLG…CLTLA → S in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB015594 mRNA Translation: BAA32533.1
AF093668 mRNA Translation: AAC78658.1
CR542046 mRNA Translation: CAG46843.1
CR542075 mRNA Translation: CAG46872.1
AK300978 mRNA Translation: BAG62600.1
AC013787 Genomic DNA No translation available.
BC009697 mRNA Translation: AAH09697.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10354.1 [O75192-1]
CCDS61751.1 [O75192-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001258501.1, NM_001271572.1 [O75192-2]
NP_003838.1, NM_003847.2 [O75192-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.31034

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000300056; ENSP00000300056; ENSG00000166821 [O75192-1]
ENST00000561257; ENSP00000453492; ENSG00000166821 [O75192-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8800

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8800

UCSC genome browser

More...
UCSCi
uc002boi.5 human [O75192-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015594 mRNA Translation: BAA32533.1
AF093668 mRNA Translation: AAC78658.1
CR542046 mRNA Translation: CAG46843.1
CR542075 mRNA Translation: CAG46872.1
AK300978 mRNA Translation: BAG62600.1
AC013787 Genomic DNA No translation available.
BC009697 mRNA Translation: AAH09697.1
CCDSiCCDS10354.1 [O75192-1]
CCDS61751.1 [O75192-2]
RefSeqiNP_001258501.1, NM_001271572.1 [O75192-2]
NP_003838.1, NM_003847.2 [O75192-1]
UniGeneiHs.31034

3D structure databases

ProteinModelPortaliO75192
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114328, 6 interactors
IntActiO75192, 1 interactor
MINTiO75192
STRINGi9606.ENSP00000300056

Protein family/group databases

TCDBi1.A.101.1.2 the peroxisomal pore-forming pex11 (pex11) family

PTM databases

iPTMnetiO75192
PhosphoSitePlusiO75192

Polymorphism and mutation databases

BioMutaiPEX11A

Proteomic databases

EPDiO75192
jPOSTiO75192
MaxQBiO75192
PaxDbiO75192
PeptideAtlasiO75192
PRIDEiO75192
ProteomicsDBi49864

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
8800
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300056; ENSP00000300056; ENSG00000166821 [O75192-1]
ENST00000561257; ENSP00000453492; ENSG00000166821 [O75192-2]
GeneIDi8800
KEGGihsa:8800
UCSCiuc002boi.5 human [O75192-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8800
DisGeNETi8800
EuPathDBiHostDB:ENSG00000166821.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PEX11A
HGNCiHGNC:8852 PEX11A
MIMi603866 gene
neXtProtiNX_O75192
OpenTargetsiENSG00000166821
PharmGKBiPA33194

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4186 Eukaryota
ENOG4111NS6 LUCA
GeneTreeiENSGT00390000014273
HOGENOMiHOG000251589
HOVERGENiHBG053771
InParanoidiO75192
KOiK13351
OMAiTQYACAL
OrthoDBi1394894at2759
PhylomeDBiO75192
TreeFamiTF325704

Enzyme and pathway databases

ReactomeiR-HSA-1989781 PPARA activates gene expression

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PEX11A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8800

Protein Ontology

More...
PROi
PR:O75192

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000166821 Expressed in 213 organ(s), highest expression level in parietal pleura
CleanExiHS_PEX11A
ExpressionAtlasiO75192 baseline and differential
GenevisibleiO75192 HS

Family and domain databases

InterProiView protein in InterPro
IPR008733 PEX11
PfamiView protein in Pfam
PF05648 PEX11, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPX11A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75192
Secondary accession number(s): B4DV88
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: November 1, 1998
Last modified: January 16, 2019
This is version 132 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again