Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rab11 family-interacting protein 3

Gene

RAB11FIP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a regulator of endocytic traffic by participating in membrane delivery. Required for the abcission step in cytokinesis, possibly by acting as an 'address tag' delivering recycling endosome membranes to the cleavage furrow during late cytokinesis. Also required for the structural integrity of the endosomal recycling compartment during interphase. May play a role in breast cancer cell motility by regulating actin cytoskeleton. Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track) (PubMed:25035494).4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi215 – 2261PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi247 – 2582PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • cell cycle Source: UniProtKB-KW
  • cell division Source: UniProtKB-KW
  • endocytic recycling Source: UniProtKB
  • negative regulation of adiponectin secretion Source: CACAO
  • protein localization to cilium Source: Ensembl
  • regulation of cytokinesis Source: UniProtKB
  • vesicle-mediated transport Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Transport
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5620916 VxPx cargo-targeting to cilium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rab11 family-interacting protein 3
Short name:
FIP3-Rab11
Short name:
Rab11-FIP3
Alternative name(s):
Arfophilin-1
EF hands-containing Rab-interacting protein
Short name:
Eferin
MU-MB-17.148
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RAB11FIP3
Synonyms:ARFO1, KIAA0665
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000090565.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17224 RAB11FIP3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608738 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75154

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi737Y → S: Abolishes Rab11-binding. 1 Publication1
Mutagenesisi738I → E: Abolishes Rab11-binding. 2 Publications1
Mutagenesisi739D → A: Abolishes Rab11-binding. 1 Publication1
Mutagenesisi746M → S: Abolishes Rab11-binding. 1 Publication1
Mutagenesisi747E → A: Abolishes Rab11-binding. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
9727

Open Targets

More...
OpenTargetsi
ENSG00000090565

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134950896

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RAB11FIP3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000738791 – 756Rab11 family-interacting protein 3Add BLAST756

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei52PhosphoserineCombined sources1
Modified residuei102Phosphoserine; by CDK1Combined sources1 Publication1
Modified residuei281Phosphoserine1 Publication1
Modified residuei348Phosphoserine1 Publication1
Modified residuei488Phosphoserine1 Publication1
Modified residuei538Phosphoserine1 Publication1
Modified residuei647Phosphoserine1 Publication1
Modified residuei648Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Ser-102 by CDK1 during metaphase, and dephosphorylated as cells enter telophase.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75154

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75154

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75154

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75154

PeptideAtlas

More...
PeptideAtlasi
O75154

PRoteomics IDEntifications database

More...
PRIDEi
O75154

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49820
49821 [O75154-2]
49822 [O75154-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75154

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75154

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000090565 Expressed in 207 organ(s), highest expression level in cortex of kidney

CleanEx database of gene expression profiles

More...
CleanExi
HS_RAB11FIP3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75154 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75154 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA028088
HPA028631
HPA030086

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Forms a complex with Rab11 (RAB11A or RAB11B) and ARF6. Interacts with RAB11A; the interaction is direct. Interacts with RAB11B, RAB25 and RAB11FIP4. Interacts with ARF6; according to PubMed:16148947, it specifically interacts with ARF6 but not ARF5. Interacts with ARF6; according to PubMed:17030804 but not PubMed:16148947. Interacts with RACGAP1/MgcRacGAP; interaction takes place during late stage of cytokinesis and is required for recruitment to the midbody. Interacts with ASAP1 and EXOC7. Interacts with dynein intermediate chain and dynactin (DCTN1) (PubMed:25035494).10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115076, 16 interactors

Database of interacting proteins

More...
DIPi
DIP-47494N

Protein interaction database and analysis system

More...
IntActi
O75154, 10 interactors

Molecular INTeraction database

More...
MINTi
O75154

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262305

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1756
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D7CX-ray1.75C/D715-756[»]
2HV8X-ray1.86D/E/F695-756[»]
4D0MX-ray6.00E/F/K/L/U/V/a/b/e/f/i/j713-756[»]
4UJ3X-ray3.00C/F/I/L/O/R/U/X695-756[»]
4UJ4X-ray4.20C/F/I/L695-756[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75154

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75154

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O75154

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini202 – 237EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini234 – 269EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini694 – 756FIP-RBDPROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni484 – 588ARF-binding domain (ABD)Add BLAST105

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili485 – 694Sequence analysisAdd BLAST210

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi5 – 197Pro-richAdd BLAST193
Compositional biasi148 – 151Poly-Ser4
Compositional biasi366 – 369Poly-Leu4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RBD-FIP domain mediates the interaction with Rab11 (RAB11A or RAB11B).1 Publication

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0982 Eukaryota
ENOG4111K32 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00440000033742

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG054059

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75154

KEGG Orthology (KO)

More...
KOi
K12485

Identification of Orthologs from Complete Genome Data

More...
OMAi
DFFPSFA

Database of Orthologous Groups

More...
OrthoDBi
1419449at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75154

TreeFam database of animal gene trees

More...
TreeFami
TF327221

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
IPR037245 FIP-RBD_C_sf
IPR019018 Rab-bd_FIP-RBD
IPR032920 Rab11-FIP3

The PANTHER Classification System

More...
PANTHERi
PTHR15726:SF6 PTHR15726:SF6, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09457 RBD-FIP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF144270 SSF144270, 1 hit
SSF47473 SSF47473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50222 EF_HAND_2, 2 hits
PS51511 FIP_RBD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75154-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASAPPASPP GSEPPGPDPE PGGPDGPGAA QLAPGPAELR LGAPVGGPDP
60 70 80 90 100
QSPGLDEPAP GAAADGGARW SAGPAPGLEG GPRDPGPSAP PPRSGPRGQL
110 120 130 140 150
ASPDAPGPGP RSEAPLPELD PLFSWTEEPE ECGPASCPES APFRLQGSSS
160 170 180 190 200
SHRARGEVDV FSPFPAPTAG ELALEQGPGS PPQPSDLSQT HPLPSEPVGS
210 220 230 240 250
QEDGPRLRAV FDALDGDGDG FVRIEDFIQF ATVYGAEQVK DLTKYLDPSG
260 270 280 290 300
LGVISFEDFY QGITAIRNGD PDGQCYGGVA SAQDEEPLAC PDEFDDFVTY
310 320 330 340 350
EANEVTDSAY MGSESTYSEC ETFTDEDTST LVHPELQPEG DADSAGGSAV
360 370 380 390 400
PSECLDAMEE PDHGALLLLP GRPHPHGQSV ITVIGGEEHF EDYGEGSEAE
410 420 430 440 450
LSPETLCNGQ LGCSDPAFLT PSPTKRLSSK KVARYLHQSG ALTMEALEDP
460 470 480 490 500
SPELMEGPEE DIADKVVFLE RRVLELEKDT AATGEQHSRL RQENLQLVHR
510 520 530 540 550
ANALEEQLKE QELRACEMVL EETRRQKELL CKMEREKSIE IENLQTRLQQ
560 570 580 590 600
LDEENSELRS CTPCLKANIE RLEEEKQKLL DEIESLTLRL SEEQENKRRM
610 620 630 640 650
GDRLSHERHQ FQRDKEATQE LIEDLRKQLE HLQLLKLEAE QRRGRSSSMG
660 670 680 690 700
LQEYHSRARE SELEQEVRRL KQDNRNLKEQ NEELNGQIIT LSIQGAKSLF
710 720 730 740 750
STAFSESLAA EISSVSRDEL MEAIQKQEEI NFRLQDYIDR IIVAIMETNP

SILEVK
Length:756
Mass (Da):82,440
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i264CEC399F28AFB9
GO
Isoform 2 (identifier: O75154-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-296: Missing.
     297-301: FVTYE → MPFLK

Note: No experimental confirmation available.
Show »
Length:460
Mass (Da):52,451
Checksum:i574FC0A764FCA199
GO
Isoform 3 (identifier: O75154-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     421-421: P → PSTDPLAAKLHSILTDEAFEFYCSQCHKQINRLEDLSARLSDLEMN

Note: No experimental confirmation available.
Show »
Length:801
Mass (Da):87,577
Checksum:i4B4D2E7E868CF67B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X6RFI8X6RFI8_HUMAN
Rab11 family-interacting protein 3
RAB11FIP3
677Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YWV4A0A0J9YWV4_HUMAN
Rab11 family-interacting protein 3
RAB11FIP3
677Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7F9H0Y7F9_HUMAN
Rab11 family-interacting protein 3
RAB11FIP3
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YXZ3A0A0J9YXZ3_HUMAN
Rab11 family-interacting protein 3
RAB11FIP3
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6X994F6X994_HUMAN
Rab11 family-interacting protein 3
RAB11FIP3
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSV1A0A0A0MSV1_HUMAN
Rab11 family-interacting protein 3
RAB11FIP3
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YY48A0A0J9YY48_HUMAN
Rab11 family-interacting protein 3
RAB11FIP3
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YWM0A0A0J9YWM0_HUMAN
Rab11 family-interacting protein 3
RAB11FIP3
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA31640 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAG57098 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0386641 – 296Missing in isoform 2. 1 PublicationAdd BLAST296
Alternative sequenceiVSP_038665297 – 301FVTYE → MPFLK in isoform 2. 1 Publication5
Alternative sequenceiVSP_038666421P → PSTDPLAAKLHSILTDEAFE FYCSQCHKQINRLEDLSARL SDLEMN in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF395731 mRNA Translation: AAL12940.1
AB014565 mRNA Translation: BAA31640.2 Different initiation.
AK293644 mRNA Translation: BAG57098.1 Different initiation.
AK303061 mRNA Translation: BAG64178.1
AE006463 Genomic DNA Translation: AAK61232.1
AL023881 Genomic DNA No translation available.
AL049542 Genomic DNA No translation available.
Z98882 Genomic DNA No translation available.
BC051360 mRNA Translation: AAH51360.1
AY130007 mRNA Translation: AAN05091.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32351.1 [O75154-1]
CCDS45364.1 [O75154-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00367

NCBI Reference Sequences

More...
RefSeqi
NP_001135744.1, NM_001142272.1 [O75154-2]
NP_055515.1, NM_014700.3 [O75154-1]
XP_005255770.1, XM_005255713.3 [O75154-3]
XP_005255772.1, XM_005255715.4
XP_011521066.1, XM_011522764.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.531642

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262305; ENSP00000262305; ENSG00000090565 [O75154-1]
ENST00000450428; ENSP00000415919; ENSG00000090565 [O75154-2]
ENST00000610934; ENSP00000484620; ENSG00000275338 [O75154-2]
ENST00000611004; ENSP00000482156; ENSG00000275338 [O75154-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9727

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9727

UCSC genome browser

More...
UCSCi
uc002chf.4 human [O75154-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF395731 mRNA Translation: AAL12940.1
AB014565 mRNA Translation: BAA31640.2 Different initiation.
AK293644 mRNA Translation: BAG57098.1 Different initiation.
AK303061 mRNA Translation: BAG64178.1
AE006463 Genomic DNA Translation: AAK61232.1
AL023881 Genomic DNA No translation available.
AL049542 Genomic DNA No translation available.
Z98882 Genomic DNA No translation available.
BC051360 mRNA Translation: AAH51360.1
AY130007 mRNA Translation: AAN05091.1
CCDSiCCDS32351.1 [O75154-1]
CCDS45364.1 [O75154-2]
PIRiT00367
RefSeqiNP_001135744.1, NM_001142272.1 [O75154-2]
NP_055515.1, NM_014700.3 [O75154-1]
XP_005255770.1, XM_005255713.3 [O75154-3]
XP_005255772.1, XM_005255715.4
XP_011521066.1, XM_011522764.2
UniGeneiHs.531642

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D7CX-ray1.75C/D715-756[»]
2HV8X-ray1.86D/E/F695-756[»]
4D0MX-ray6.00E/F/K/L/U/V/a/b/e/f/i/j713-756[»]
4UJ3X-ray3.00C/F/I/L/O/R/U/X695-756[»]
4UJ4X-ray4.20C/F/I/L695-756[»]
ProteinModelPortaliO75154
SMRiO75154
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115076, 16 interactors
DIPiDIP-47494N
IntActiO75154, 10 interactors
MINTiO75154
STRINGi9606.ENSP00000262305

PTM databases

iPTMnetiO75154
PhosphoSitePlusiO75154

Polymorphism and mutation databases

BioMutaiRAB11FIP3

Proteomic databases

EPDiO75154
jPOSTiO75154
MaxQBiO75154
PaxDbiO75154
PeptideAtlasiO75154
PRIDEiO75154
ProteomicsDBi49820
49821 [O75154-2]
49822 [O75154-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262305; ENSP00000262305; ENSG00000090565 [O75154-1]
ENST00000450428; ENSP00000415919; ENSG00000090565 [O75154-2]
ENST00000610934; ENSP00000484620; ENSG00000275338 [O75154-2]
ENST00000611004; ENSP00000482156; ENSG00000275338 [O75154-1]
GeneIDi9727
KEGGihsa:9727
UCSCiuc002chf.4 human [O75154-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9727
DisGeNETi9727
EuPathDBiHostDB:ENSG00000090565.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RAB11FIP3
HGNCiHGNC:17224 RAB11FIP3
HPAiHPA028088
HPA028631
HPA030086
MIMi608738 gene
neXtProtiNX_O75154
OpenTargetsiENSG00000090565
PharmGKBiPA134950896

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0982 Eukaryota
ENOG4111K32 LUCA
GeneTreeiENSGT00440000033742
HOVERGENiHBG054059
InParanoidiO75154
KOiK12485
OMAiDFFPSFA
OrthoDBi1419449at2759
PhylomeDBiO75154
TreeFamiTF327221

Enzyme and pathway databases

ReactomeiR-HSA-5620916 VxPx cargo-targeting to cilium

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RAB11FIP3 human
EvolutionaryTraceiO75154

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RAB11FIP3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9727

Protein Ontology

More...
PROi
PR:O75154

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000090565 Expressed in 207 organ(s), highest expression level in cortex of kidney
CleanExiHS_RAB11FIP3
ExpressionAtlasiO75154 baseline and differential
GenevisibleiO75154 HS

Family and domain databases

InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
IPR037245 FIP-RBD_C_sf
IPR019018 Rab-bd_FIP-RBD
IPR032920 Rab11-FIP3
PANTHERiPTHR15726:SF6 PTHR15726:SF6, 2 hits
PfamiView protein in Pfam
PF09457 RBD-FIP, 1 hit
SUPFAMiSSF144270 SSF144270, 1 hit
SSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 2 hits
PS51511 FIP_RBD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRFIP3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75154
Secondary accession number(s): B0QYI8
, B0QYT8, B1AHQ0, B4DEI7, B4DZR6, Q4VXV7, Q7Z5E9, Q9H155, Q9H1G0, Q9NUI0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: November 1, 1998
Last modified: January 16, 2019
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again