Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (07 Apr 2021)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Autophagy-related protein 13

Gene

ATG13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation.6 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAutophagy

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
O75143

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1632852, Macroautophagy

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O75143

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.A.15.2.1, the autophagy-related phagophore-formation transporter (apt) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Autophagy-related protein 13
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATG13
Synonyms:KIAA0652
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29091, ATG13

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615088, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75143

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000175224.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi127S → H: Abolishes interaction with ATG101; when associated with D-133. 1 Publication1
Mutagenesisi131I → D: Decreases interaction with ATG101; when associated with D-134. 1 Publication1
Mutagenesisi133R → D: Abolishes interaction with ATG101; when associated with H-127. 1 Publication1
Mutagenesisi134V → D: Decreases interaction with ATG101; when associated with D-131. 1 Publication1
Mutagenesisi444F → A: Decreases interaction with MAP1LC3A. 1 Publication1
Mutagenesisi447I → A: Decreases interaction with MAP1LC3A. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
9776

Open Targets

More...
OpenTargetsi
ENSG00000175224

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165543187

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O75143, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATG13

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000507671 – 517Autophagy-related protein 13Add BLAST517

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei355Phosphoserine; by ULK1Combined sources1 Publication1
Modified residuei356PhosphoserineCombined sources1
Modified residuei361PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by ULK1, ULK2 and mTOR. Phosphorylation status depends on nutrient-rich conditions; dephosphorylated during starvation or following treatment with rapamycin. ULK1-mediated phosphorylation of ATG13 at Ser-355 is required for efficient clearance of depolarized mitochondria.6 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75143

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75143

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O75143

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75143

PeptideAtlas

More...
PeptideAtlasi
O75143

PRoteomics IDEntifications database

More...
PRIDEi
O75143

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
23169
4042
49803 [O75143-1]
49804 [O75143-2]
49805 [O75143-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75143

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75143

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000175224, Expressed in right testis and 241 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75143, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75143, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000175224, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of a complex consisting of ATG13, ULK1 and RB1CC1 (PubMed:19597335, PubMed:19211835, PubMed:19225151, PubMed:24290141).

Interacts with ATG101 (PubMed:19597335, PubMed:19287211, PubMed:26299944).

Interacts with ULK1 (via C-terminus); this interaction is increased in the absence of TMEM39A (PubMed:19287211, PubMed:21855797, PubMed:18936157, PubMed:31806350).

Interacts with ULK2 (via C-terminus) (PubMed:19225151, PubMed:18936157).

Interacts (via the LIR motif) with GABARAP, GABARAPL, GABARAPL2 (PubMed:23043107).

Interacts (via the LIR motif) with MAP1LC3A, MAP1LC3B and MAP1LC3C (PubMed:24290141).

Interacts with TAB2 and TAB3 (PubMed:21976705).

Interacts with C9orf72 (PubMed:27334615).

Interacts with RB1CC1; this interaction is increased in the absence of TMEM39A (PubMed:31806350).

12 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115120, 35 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-373, ULK1-ATG13-RB1CC1-ATG101 autophagy initiation complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O75143

Database of interacting proteins

More...
DIPi
DIP-60540N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
O75143

Protein interaction database and analysis system

More...
IntActi
O75143, 26 interactors

Molecular INTeraction database

More...
MINTi
O75143

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000432412

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O75143, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1517
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75143

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni127 – 134Important for interaction with ATG1011 Publication8

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi444 – 447LIR1 Publication4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi41 – 44Poly-Ser4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The LIR motif (LC3-interacting region) is required for the interaction with the ATG8 family proteins GABARAP, GABARAPL, GABARAPL2, and MAP1LC3A.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ATG13 family. Metazoan subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3874, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007055

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_036365_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75143

Identification of Orthologs from Complete Genome Data

More...
OMAi
GVGSADM

Database of Orthologous Groups

More...
OrthoDBi
926357at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75143

TreeFam database of animal gene trees

More...
TreeFami
TF321599

Family and domain databases

Database of protein disorder

More...
DisProti
DP01731

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.900.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040182, ATG13
IPR018731, Atg13_N
IPR036570, HORMA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR13430, PTHR13430, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10033, ATG13, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 5 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75143-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METDLNSQDR KDLDKFIKFF ALKTVQVIVQ ARLGEKICTR SSSSPTGSDW
60 70 80 90 100
FNLAIKDIPE VTHEAKKALA GQLPAVGRSM CVEISLKTSE GDSMELEIWC
110 120 130 140 150
LEMNEKCDKE IKVSYTVYNR LSLLLKSLLA ITRVTPAYRL SRKQGHEYVI
160 170 180 190 200
LYRIYFGEVQ LSGLGEGFQT VRVGTVGTPV GTITLSCAYR INLAFMSTRQ
210 220 230 240 250
FERTPPIMGI IIDHFVDRPY PSSSPMHPCN YRTAGEDTGV IYPSVEDSQE
260 270 280 290 300
VCTTSFSTSP PSQLSSSRLS YQPAALGVGS ADLAYPVVFA AGLNATHPHQ
310 320 330 340 350
LMVPGKEGGV PLAPNQPVHG TQADQERLAT CTPSDRTHCA ATPSSSEDTE
360 370 380 390 400
TVSNSSEGRA SPHDVLETIF VRKVGAFVNK PINQVTLTSL DIPFAMFAPK
410 420 430 440 450
NLELEDTDPM VNPPDSPETE SPLQGSLHSD GSSGGSSGNT HDDFVMIDFK
460 470 480 490 500
PAFSKDDILP MDLGTFYREF QNPPQLSSLS IDIGAQSMAE DLDSLPEKLA
510
VHEKNVREFD AFVETLQ
Length:517
Mass (Da):56,572
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4D6905985EAB78A7
GO
Isoform 2 (identifier: O75143-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-301: Missing.

Show »
Length:480
Mass (Da):52,823
Checksum:i4EB66893A99956A1
GO
Isoform 3 (identifier: O75143-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-301: Missing.
     428-442: HSDGSSGGSSGNTHD → PCSWPLPCLLSPSTV
     443-517: Missing.

Show »
Length:405
Mass (Da):44,487
Checksum:iF2CE69C9082ABFA5
GO
Isoform 4 (identifier: O75143-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-79: Missing.
     263-299: Missing.

Show »
Length:401
Mass (Da):44,093
Checksum:i157846C39C54650F
GO
Isoform 5 (identifier: O75143-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-262: S → SQCVFTVTKAHFQTPTPVVTDTLRVPMAGLAFSH

Show »
Length:550
Mass (Da):60,155
Checksum:i0965E80906316BD0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J9JIF6J9JIF6_HUMAN
Autophagy-related protein 13
ATG13
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPR2E9PPR2_HUMAN
Autophagy-related protein 13
ATG13
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YEM7H0YEM7_HUMAN
Autophagy-related protein 13
ATG13
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRU6J3KRU6_HUMAN
Autophagy-related protein 13
ATG13
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDR0H0YDR0_HUMAN
Autophagy-related protein 13
ATG13
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCL5H0YCL5_HUMAN
Autophagy-related protein 13
ATG13
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QR83J3QR83_HUMAN
Autophagy-related protein 13
ATG13
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRL1J3QRL1_HUMAN
Autophagy-related protein 13
ATG13
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLH7J3QLH7_HUMAN
Autophagy-related protein 13
ATG13
13Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YF43H0YF43_HUMAN
Autophagy-related protein 13
ATG13
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA31627 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAD97323 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0445031 – 79Missing in isoform 4. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_044640262S → SQCVFTVTKAHFQTPTPVVT DTLRVPMAGLAFSH in isoform 5. 1 Publication1
Alternative sequenceiVSP_044504263 – 299Missing in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_002431265 – 301Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_002432428 – 442HSDGS…GNTHD → PCSWPLPCLLSPSTV in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_002433443 – 517Missing in isoform 3. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB014552 mRNA Translation: BAA31627.2 Different initiation.
AK023867 mRNA Translation: BAB14707.1
AK294110 mRNA Translation: BAG57445.1
AK223603 mRNA Translation: BAD97323.1 Different initiation.
AC115088 Genomic DNA No translation available.
AC127035 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW67985.1
CH471064 Genomic DNA Translation: EAW67986.1
CH471064 Genomic DNA Translation: EAW67987.1
CH471064 Genomic DNA Translation: EAW67988.1
CH471064 Genomic DNA Translation: EAW67989.1
CH471064 Genomic DNA Translation: EAW67990.1
CH471064 Genomic DNA Translation: EAW67991.1
BC001331 mRNA Translation: AAH01331.1
BC002378 mRNA Translation: AAH02378.1
BC006191 mRNA Translation: AAH06191.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44582.1 [O75143-1]
CCDS55760.1 [O75143-5]
CCDS55761.1 [O75143-4]
CCDS7921.1 [O75143-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001136145.1, NM_001142673.2 [O75143-1]
NP_001192048.1, NM_001205119.1 [O75143-5]
NP_001192049.1, NM_001205120.1 [O75143-1]
NP_001192050.1, NM_001205121.1 [O75143-2]
NP_001192051.1, NM_001205122.1 [O75143-4]
NP_001333240.1, NM_001346311.1 [O75143-5]
NP_001333241.1, NM_001346312.1 [O75143-5]
NP_001333242.1, NM_001346313.1 [O75143-5]
NP_001333243.1, NM_001346314.1 [O75143-5]
NP_001333244.1, NM_001346315.1 [O75143-5]
NP_001333245.1, NM_001346316.1 [O75143-5]
NP_001333248.1, NM_001346319.1 [O75143-1]
NP_001333249.1, NM_001346320.1 [O75143-1]
NP_001333250.1, NM_001346321.1 [O75143-1]
NP_001333251.1, NM_001346322.1 [O75143-1]
NP_001333252.1, NM_001346323.1 [O75143-1]
NP_001333253.1, NM_001346324.1 [O75143-1]
NP_001333254.1, NM_001346325.1 [O75143-1]
NP_001333255.1, NM_001346326.1 [O75143-1]
NP_001333256.1, NM_001346327.1 [O75143-1]
NP_001333257.1, NM_001346328.1 [O75143-1]
NP_001333258.1, NM_001346329.1 [O75143-1]
NP_001333259.1, NM_001346330.1 [O75143-1]
NP_001333260.1, NM_001346331.1 [O75143-1]
NP_001333261.1, NM_001346332.1 [O75143-1]
NP_001333271.1, NM_001346342.1 [O75143-2]
NP_001333273.1, NM_001346344.1 [O75143-2]
NP_001333275.1, NM_001346346.1 [O75143-2]
NP_001333277.1, NM_001346348.1 [O75143-2]
NP_001333278.1, NM_001346349.1 [O75143-2]
NP_001333279.1, NM_001346350.1 [O75143-2]
NP_001333280.1, NM_001346351.1 [O75143-2]
NP_001333281.1, NM_001346352.1 [O75143-2]
NP_001333282.1, NM_001346353.1 [O75143-2]
NP_001333283.1, NM_001346354.1 [O75143-2]
NP_055556.2, NM_014741.4 [O75143-2]
XP_005253322.1, XM_005253265.2 [O75143-5]
XP_005253323.1, XM_005253266.2 [O75143-5]
XP_005253325.1, XM_005253268.2 [O75143-5]
XP_006718459.1, XM_006718396.2 [O75143-5]
XP_011518795.1, XM_011520493.1 [O75143-5]
XP_011518798.1, XM_011520496.2 [O75143-5]
XP_011518801.1, XM_011520499.2 [O75143-5]
XP_016874088.1, XM_017018599.1 [O75143-5]
XP_016874092.1, XM_017018603.1 [O75143-1]
XP_016874096.1, XM_017018607.1 [O75143-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000359513; ENSP00000352500; ENSG00000175224 [O75143-1]
ENST00000524625; ENSP00000433543; ENSG00000175224 [O75143-2]
ENST00000526508; ENSP00000431974; ENSG00000175224 [O75143-1]
ENST00000528494; ENSP00000432412; ENSG00000175224 [O75143-5]
ENST00000529655; ENSP00000433756; ENSG00000175224 [O75143-2]
ENST00000530500; ENSP00000434390; ENSG00000175224 [O75143-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9776

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9776

UCSC genome browser

More...
UCSCi
uc001ncz.4, human [O75143-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014552 mRNA Translation: BAA31627.2 Different initiation.
AK023867 mRNA Translation: BAB14707.1
AK294110 mRNA Translation: BAG57445.1
AK223603 mRNA Translation: BAD97323.1 Different initiation.
AC115088 Genomic DNA No translation available.
AC127035 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW67985.1
CH471064 Genomic DNA Translation: EAW67986.1
CH471064 Genomic DNA Translation: EAW67987.1
CH471064 Genomic DNA Translation: EAW67988.1
CH471064 Genomic DNA Translation: EAW67989.1
CH471064 Genomic DNA Translation: EAW67990.1
CH471064 Genomic DNA Translation: EAW67991.1
BC001331 mRNA Translation: AAH01331.1
BC002378 mRNA Translation: AAH02378.1
BC006191 mRNA Translation: AAH06191.1
CCDSiCCDS44582.1 [O75143-1]
CCDS55760.1 [O75143-5]
CCDS55761.1 [O75143-4]
CCDS7921.1 [O75143-2]
RefSeqiNP_001136145.1, NM_001142673.2 [O75143-1]
NP_001192048.1, NM_001205119.1 [O75143-5]
NP_001192049.1, NM_001205120.1 [O75143-1]
NP_001192050.1, NM_001205121.1 [O75143-2]
NP_001192051.1, NM_001205122.1 [O75143-4]
NP_001333240.1, NM_001346311.1 [O75143-5]
NP_001333241.1, NM_001346312.1 [O75143-5]
NP_001333242.1, NM_001346313.1 [O75143-5]
NP_001333243.1, NM_001346314.1 [O75143-5]
NP_001333244.1, NM_001346315.1 [O75143-5]
NP_001333245.1, NM_001346316.1 [O75143-5]
NP_001333248.1, NM_001346319.1 [O75143-1]
NP_001333249.1, NM_001346320.1 [O75143-1]
NP_001333250.1, NM_001346321.1 [O75143-1]
NP_001333251.1, NM_001346322.1 [O75143-1]
NP_001333252.1, NM_001346323.1 [O75143-1]
NP_001333253.1, NM_001346324.1 [O75143-1]
NP_001333254.1, NM_001346325.1 [O75143-1]
NP_001333255.1, NM_001346326.1 [O75143-1]
NP_001333256.1, NM_001346327.1 [O75143-1]
NP_001333257.1, NM_001346328.1 [O75143-1]
NP_001333258.1, NM_001346329.1 [O75143-1]
NP_001333259.1, NM_001346330.1 [O75143-1]
NP_001333260.1, NM_001346331.1 [O75143-1]
NP_001333261.1, NM_001346332.1 [O75143-1]
NP_001333271.1, NM_001346342.1 [O75143-2]
NP_001333273.1, NM_001346344.1 [O75143-2]
NP_001333275.1, NM_001346346.1 [O75143-2]
NP_001333277.1, NM_001346348.1 [O75143-2]
NP_001333278.1, NM_001346349.1 [O75143-2]
NP_001333279.1, NM_001346350.1 [O75143-2]
NP_001333280.1, NM_001346351.1 [O75143-2]
NP_001333281.1, NM_001346352.1 [O75143-2]
NP_001333282.1, NM_001346353.1 [O75143-2]
NP_001333283.1, NM_001346354.1 [O75143-2]
NP_055556.2, NM_014741.4 [O75143-2]
XP_005253322.1, XM_005253265.2 [O75143-5]
XP_005253323.1, XM_005253266.2 [O75143-5]
XP_005253325.1, XM_005253268.2 [O75143-5]
XP_006718459.1, XM_006718396.2 [O75143-5]
XP_011518795.1, XM_011520493.1 [O75143-5]
XP_011518798.1, XM_011520496.2 [O75143-5]
XP_011518801.1, XM_011520499.2 [O75143-5]
XP_016874088.1, XM_017018599.1 [O75143-5]
XP_016874092.1, XM_017018603.1 [O75143-1]
XP_016874096.1, XM_017018607.1 [O75143-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WANX-ray1.77A/B436-447[»]
3WAOX-ray2.60A/B/C/D436-447[»]
3WAPX-ray3.10A436-447[»]
5C50X-ray1.63B12-200[»]
5XUYX-ray2.20A/C1-190[»]
5XV1X-ray2.51A/C1-190[»]
5XV3X-ray2.57A/C1-190[»]
5XV4X-ray2.95A/C/E/G/I/K/M/O1-190[»]
5XV6X-ray2.46A1-190[»]
6HYNX-ray1.14A441-454[»]
SMRiO75143
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115120, 35 interactors
ComplexPortaliCPX-373, ULK1-ATG13-RB1CC1-ATG101 autophagy initiation complex
CORUMiO75143
DIPiDIP-60540N
ELMiO75143
IntActiO75143, 26 interactors
MINTiO75143
STRINGi9606.ENSP00000432412

Protein family/group databases

TCDBi9.A.15.2.1, the autophagy-related phagophore-formation transporter (apt) family

PTM databases

iPTMnetiO75143
PhosphoSitePlusiO75143

Genetic variation databases

BioMutaiATG13

Proteomic databases

EPDiO75143
jPOSTiO75143
MassIVEiO75143
MaxQBiO75143
PeptideAtlasiO75143
PRIDEiO75143
ProteomicsDBi23169
4042
49803 [O75143-1]
49804 [O75143-2]
49805 [O75143-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26361, 610 antibodies

The DNASU plasmid repository

More...
DNASUi
9776

Genome annotation databases

EnsembliENST00000359513; ENSP00000352500; ENSG00000175224 [O75143-1]
ENST00000524625; ENSP00000433543; ENSG00000175224 [O75143-2]
ENST00000526508; ENSP00000431974; ENSG00000175224 [O75143-1]
ENST00000528494; ENSP00000432412; ENSG00000175224 [O75143-5]
ENST00000529655; ENSP00000433756; ENSG00000175224 [O75143-2]
ENST00000530500; ENSP00000434390; ENSG00000175224 [O75143-4]
GeneIDi9776
KEGGihsa:9776
UCSCiuc001ncz.4, human [O75143-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9776
DisGeNETi9776

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATG13
HGNCiHGNC:29091, ATG13
HPAiENSG00000175224, Low tissue specificity
MIMi615088, gene
neXtProtiNX_O75143
OpenTargetsiENSG00000175224
PharmGKBiPA165543187
VEuPathDBiHostDB:ENSG00000175224.16

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3874, Eukaryota
GeneTreeiENSGT00390000007055
HOGENOMiCLU_036365_0_0_1
InParanoidiO75143
OMAiGVGSADM
OrthoDBi926357at2759
PhylomeDBiO75143
TreeFamiTF321599

Enzyme and pathway databases

PathwayCommonsiO75143
ReactomeiR-HSA-1632852, Macroautophagy
SIGNORiO75143

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9776, 20 hits in 1003 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATG13, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Autophagy-related_protein_13

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9776
PharosiO75143, Tbio

Protein Ontology

More...
PROi
PR:O75143
RNActiO75143, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000175224, Expressed in right testis and 241 other tissues
ExpressionAtlasiO75143, baseline and differential
GenevisibleiO75143, HS

Family and domain databases

DisProtiDP01731
Gene3Di3.30.900.10, 1 hit
InterProiView protein in InterPro
IPR040182, ATG13
IPR018731, Atg13_N
IPR036570, HORMA_dom_sf
PANTHERiPTHR13430, PTHR13430, 1 hit
PfamiView protein in Pfam
PF10033, ATG13, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATG13_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75143
Secondary accession number(s): B4DFI4
, D3DQQ1, D3DQQ2, E9PQZ8, Q53EN6, Q9BRL3, Q9H8B0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: November 1, 1998
Last modified: April 7, 2021
This is version 169 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again