Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Autophagy-related protein 13

Gene

ATG13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation.6 Publications

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processAutophagy

Enzyme and pathway databases

ReactomeiR-HSA-1632852 Macroautophagy
SIGNORiO75143

Protein family/group databases

TCDBi9.A.15.2.1 the autophagy-related phagophore-formation transporter (apt) family

Names & Taxonomyi

Protein namesi
Recommended name:
Autophagy-related protein 13
Gene namesi
Name:ATG13
Synonyms:KIAA0652
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000175224.16
HGNCiHGNC:29091 ATG13
MIMi615088 gene
neXtProtiNX_O75143

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi127S → H: Abolishes interaction with ATG101; when associated with D-133. 1 Publication1
Mutagenesisi131I → D: Decreases interaction with ATG101; when associated with D-134. 1 Publication1
Mutagenesisi133R → D: Abolishes interaction with ATG101; when associated with H-127. 1 Publication1
Mutagenesisi134V → D: Decreases interaction with ATG101; when associated with D-131. 1 Publication1
Mutagenesisi444F → A: Decreases interaction with MAP1LC3A. 1 Publication1
Mutagenesisi447I → A: Decreases interaction with MAP1LC3A. 1 Publication1

Organism-specific databases

DisGeNETi9776
OpenTargetsiENSG00000175224
PharmGKBiPA165543187

Polymorphism and mutation databases

BioMutaiATG13

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000507671 – 517Autophagy-related protein 13Add BLAST517

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei355Phosphoserine; by ULK1Combined sources1 Publication1
Modified residuei356PhosphoserineCombined sources1
Modified residuei361PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by ULK1, ULK2 and mTOR. Phosphorylation status depends on nutrient-rich conditions; dephosphorylated during starvation or following treatment with rapamycin. ULK1-mediated phosphorylation of ATG13 at Ser-355 is required for efficient clearance of depolarized mitochondria.6 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiO75143
MaxQBiO75143
PeptideAtlasiO75143
PRIDEiO75143
ProteomicsDBi49803
49804 [O75143-2]
49805 [O75143-3]

PTM databases

iPTMnetiO75143
PhosphoSitePlusiO75143

Expressioni

Gene expression databases

BgeeiENSG00000175224 Expressed in 228 organ(s), highest expression level in right testis
CleanExiHS_KIAA0652
ExpressionAtlasiO75143 baseline and differential
GenevisibleiO75143 HS

Organism-specific databases

HPAiHPA039350

Interactioni

Subunit structurei

Part of a complex consisting of ATG13, ULK1 and RB1CC1 (PubMed:19597335, PubMed:19211835, PubMed:19225151, PubMed:24290141). Interacts with ATG101 (PubMed:19597335, PubMed:19287211, PubMed:26299944). Interacts with ULK1 (via C-terminus) (PubMed:19287211, PubMed:21855797, PubMed:18936157). Interacts with ULK2 (via C-terminus) (PubMed:19225151, PubMed:18936157). Interacts (via the LIR motif) with GABARAP, GABARAPL, GABARAPL2 (PubMed:23043107). Interacts (via the LIR motif) with MAP1LC3A, MAP1LC3B and MAP1LC3C (PubMed:24290141). Interacts with TAB2 and TAB3 (PubMed:21976705). Interacts with C9orf72 (PubMed:27334615).11 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115120, 22 interactors
ComplexPortaliCPX-373 ULK1-ATG13-RB1CC1-ATG101 autophagy initiation complex
CORUMiO75143
DIPiDIP-60540N
ELMiO75143
IntActiO75143, 19 interactors
MINTiO75143

Structurei

Secondary structure

1517
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO75143
SMRiO75143
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni127 – 134Important for interaction with ATG1011 Publication8

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi444 – 447LIR1 Publication4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi41 – 44Poly-Ser4

Domaini

The LIR motif (LC3-interacting region) is required for the interaction with the ATG8 family proteins GABARAP, GABARAPL, GABARAPL2, and MAP1LC3A.1 Publication

Sequence similaritiesi

Belongs to the ATG13 family. Metazoan subfamily.Curated

Phylogenomic databases

GeneTreeiENSGT00390000007055
HOGENOMiHOG000008446
InParanoidiO75143
KOiK08331
OMAiKICTRSS
OrthoDBiEOG091G0TEK
PhylomeDBiO75143
TreeFamiTF321599

Family and domain databases

Gene3Di3.30.900.10, 1 hit
InterProiView protein in InterPro
IPR018731 Atg13
IPR036570 HORMA_dom_sf
PfamiView protein in Pfam
PF10033 ATG13, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 5 described isoforms and 13 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: O75143-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METDLNSQDR KDLDKFIKFF ALKTVQVIVQ ARLGEKICTR SSSSPTGSDW
60 70 80 90 100
FNLAIKDIPE VTHEAKKALA GQLPAVGRSM CVEISLKTSE GDSMELEIWC
110 120 130 140 150
LEMNEKCDKE IKVSYTVYNR LSLLLKSLLA ITRVTPAYRL SRKQGHEYVI
160 170 180 190 200
LYRIYFGEVQ LSGLGEGFQT VRVGTVGTPV GTITLSCAYR INLAFMSTRQ
210 220 230 240 250
FERTPPIMGI IIDHFVDRPY PSSSPMHPCN YRTAGEDTGV IYPSVEDSQE
260 270 280 290 300
VCTTSFSTSP PSQLSSSRLS YQPAALGVGS ADLAYPVVFA AGLNATHPHQ
310 320 330 340 350
LMVPGKEGGV PLAPNQPVHG TQADQERLAT CTPSDRTHCA ATPSSSEDTE
360 370 380 390 400
TVSNSSEGRA SPHDVLETIF VRKVGAFVNK PINQVTLTSL DIPFAMFAPK
410 420 430 440 450
NLELEDTDPM VNPPDSPETE SPLQGSLHSD GSSGGSSGNT HDDFVMIDFK
460 470 480 490 500
PAFSKDDILP MDLGTFYREF QNPPQLSSLS IDIGAQSMAE DLDSLPEKLA
510
VHEKNVREFD AFVETLQ
Length:517
Mass (Da):56,572
Last modified:November 1, 1998 - v1
Checksum:i4D6905985EAB78A7
GO
Isoform 2 (identifier: O75143-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-301: Missing.

Show »
Length:480
Mass (Da):52,823
Checksum:i4EB66893A99956A1
GO
Isoform 3 (identifier: O75143-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-301: Missing.
     428-442: HSDGSSGGSSGNTHD → PCSWPLPCLLSPSTV
     443-517: Missing.

Show »
Length:405
Mass (Da):44,487
Checksum:iF2CE69C9082ABFA5
GO
Isoform 4 (identifier: O75143-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-79: Missing.
     263-299: Missing.

Show »
Length:401
Mass (Da):44,093
Checksum:i157846C39C54650F
GO
Isoform 5 (identifier: O75143-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-262: S → SQCVFTVTKAHFQTPTPVVTDTLRVPMAGLAFSH

Note: No experimental confirmation available.
Show »
Length:550
Mass (Da):60,155
Checksum:i0965E80906316BD0
GO

Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J9JIF6J9JIF6_HUMAN
Autophagy-related protein 13
ATG13
198Annotation score:
E9PPR2E9PPR2_HUMAN
Autophagy-related protein 13
ATG13
119Annotation score:
J3QRL1J3QRL1_HUMAN
Autophagy-related protein 13
ATG13
50Annotation score:
J3KRU6J3KRU6_HUMAN
Autophagy-related protein 13
ATG13
56Annotation score:
J3QR83J3QR83_HUMAN
Autophagy-related protein 13
ATG13
38Annotation score:
H0YEM7H0YEM7_HUMAN
Autophagy-related protein 13
ATG13
193Annotation score:
J3KST9J3KST9_HUMAN
Autophagy-related protein 13
ATG13
33Annotation score:
H0YCL5H0YCL5_HUMAN
Autophagy-related protein 13
ATG13
78Annotation score:
J3QR16J3QR16_HUMAN
Autophagy-related protein 13
ATG13
27Annotation score:
H0YDR0H0YDR0_HUMAN
Autophagy-related protein 13
ATG13
47Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence BAA31627 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAD97323 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445031 – 79Missing in isoform 4. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_044640262S → SQCVFTVTKAHFQTPTPVVT DTLRVPMAGLAFSH in isoform 5. 1 Publication1
Alternative sequenceiVSP_044504263 – 299Missing in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_002431265 – 301Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_002432428 – 442HSDGS…GNTHD → PCSWPLPCLLSPSTV in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_002433443 – 517Missing in isoform 3. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014552 mRNA Translation: BAA31627.2 Different initiation.
AK023867 mRNA Translation: BAB14707.1
AK294110 mRNA Translation: BAG57445.1
AK223603 mRNA Translation: BAD97323.1 Different initiation.
AC115088 Genomic DNA No translation available.
AC127035 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW67985.1
CH471064 Genomic DNA Translation: EAW67986.1
CH471064 Genomic DNA Translation: EAW67987.1
CH471064 Genomic DNA Translation: EAW67988.1
CH471064 Genomic DNA Translation: EAW67989.1
CH471064 Genomic DNA Translation: EAW67990.1
CH471064 Genomic DNA Translation: EAW67991.1
BC001331 mRNA Translation: AAH01331.1
BC002378 mRNA Translation: AAH02378.1
BC006191 mRNA Translation: AAH06191.1
CCDSiCCDS44582.1 [O75143-1]
CCDS55760.1 [O75143-5]
CCDS55761.1 [O75143-4]
CCDS7921.1 [O75143-2]
RefSeqiNP_001136145.1, NM_001142673.2 [O75143-1]
NP_001192048.1, NM_001205119.1 [O75143-5]
NP_001192049.1, NM_001205120.1 [O75143-1]
NP_001192050.1, NM_001205121.1 [O75143-2]
NP_001192051.1, NM_001205122.1 [O75143-4]
NP_001333240.1, NM_001346311.1 [O75143-5]
NP_001333241.1, NM_001346312.1 [O75143-5]
NP_001333242.1, NM_001346313.1 [O75143-5]
NP_001333243.1, NM_001346314.1 [O75143-5]
NP_001333244.1, NM_001346315.1 [O75143-5]
NP_001333245.1, NM_001346316.1 [O75143-5]
NP_001333248.1, NM_001346319.1 [O75143-1]
NP_001333249.1, NM_001346320.1 [O75143-1]
NP_001333250.1, NM_001346321.1 [O75143-1]
NP_001333251.1, NM_001346322.1 [O75143-1]
NP_001333252.1, NM_001346323.1 [O75143-1]
NP_001333253.1, NM_001346324.1 [O75143-1]
NP_001333254.1, NM_001346325.1 [O75143-1]
NP_001333255.1, NM_001346326.1 [O75143-1]
NP_001333256.1, NM_001346327.1 [O75143-1]
NP_001333257.1, NM_001346328.1 [O75143-1]
NP_001333258.1, NM_001346329.1 [O75143-1]
NP_001333259.1, NM_001346330.1 [O75143-1]
NP_001333260.1, NM_001346331.1 [O75143-1]
NP_001333261.1, NM_001346332.1 [O75143-1]
NP_001333271.1, NM_001346342.1 [O75143-2]
NP_001333273.1, NM_001346344.1 [O75143-2]
NP_001333275.1, NM_001346346.1 [O75143-2]
NP_001333277.1, NM_001346348.1 [O75143-2]
NP_001333278.1, NM_001346349.1 [O75143-2]
NP_001333279.1, NM_001346350.1 [O75143-2]
NP_001333280.1, NM_001346351.1 [O75143-2]
NP_001333281.1, NM_001346352.1 [O75143-2]
NP_001333282.1, NM_001346353.1 [O75143-2]
NP_001333283.1, NM_001346354.1 [O75143-2]
NP_055556.2, NM_014741.4 [O75143-2]
XP_005253322.1, XM_005253265.2 [O75143-5]
XP_005253323.1, XM_005253266.2 [O75143-5]
XP_005253325.1, XM_005253268.2 [O75143-5]
XP_006718459.1, XM_006718396.2 [O75143-5]
XP_011518795.1, XM_011520493.1 [O75143-5]
XP_011518798.1, XM_011520496.2 [O75143-5]
XP_011518801.1, XM_011520499.2 [O75143-5]
XP_016874088.1, XM_017018599.1 [O75143-5]
XP_016874092.1, XM_017018603.1 [O75143-1]
XP_016874096.1, XM_017018607.1 [O75143-1]
UniGeneiHs.127403

Genome annotation databases

EnsembliENST00000359513; ENSP00000352500; ENSG00000175224 [O75143-1]
ENST00000524625; ENSP00000433543; ENSG00000175224 [O75143-2]
ENST00000526508; ENSP00000431974; ENSG00000175224 [O75143-1]
ENST00000528494; ENSP00000432412; ENSG00000175224 [O75143-5]
ENST00000529655; ENSP00000433756; ENSG00000175224 [O75143-2]
ENST00000530500; ENSP00000434390; ENSG00000175224 [O75143-4]
GeneIDi9776
KEGGihsa:9776
UCSCiuc001ncz.4 human [O75143-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiATG13_HUMAN
AccessioniPrimary (citable) accession number: O75143
Secondary accession number(s): B4DFI4
, D3DQQ1, D3DQQ2, E9PQZ8, Q53EN6, Q9BRL3, Q9H8B0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: November 1, 1998
Last modified: September 12, 2018
This is version 149 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again