Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (08 May 2019)
Sequence version 2 (28 Nov 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein cordon-bleu

Gene

COBL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an important role in the reorganization of the actin cytoskeleton. Regulates neuron morphogenesis and increases branching of axons and dendrites. Regulates dendrite branching in Purkinje cells (By similarity). Binds to and sequesters actin monomers (G actin). Nucleates actin polymerization by assembling three actin monomers in cross-filament orientation and thereby promotes growth of actin filaments at the barbed end. Can also mediate actin depolymerization at barbed ends and severing of actin filaments. Promotes formation of cell ruffles.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein cordon-bleu
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:COBL
Synonyms:KIAA0633
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:22199 COBL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610317 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75128

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23242

Open Targets

More...
OpenTargetsi
ENSG00000106078

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134869580

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
COBL

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002604911 – 1261Protein cordon-bleuAdd BLAST1261

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei47PhosphoserineBy similarity1
Modified residuei212PhosphoserineBy similarity1
Modified residuei235PhosphoserineBy similarity1
Modified residuei269PhosphoserineCombined sources1
Modified residuei321PhosphoserineBy similarity1
Modified residuei324PhosphoserineCombined sources1
Modified residuei347PhosphoserineCombined sources1
Modified residuei447PhosphothreonineBy similarity1
Modified residuei574PhosphoserineCombined sources1
Modified residuei578PhosphoserineCombined sources1
Modified residuei741PhosphoserineCombined sources1
Modified residuei815PhosphoserineCombined sources1
Modified residuei962PhosphoserineCombined sources1
Modified residuei1192PhosphoserineCombined sources1
Modified residuei1227PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75128

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75128

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75128

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75128

PeptideAtlas

More...
PeptideAtlasi
O75128

PRoteomics IDEntifications database

More...
PRIDEi
O75128

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49781
49782 [O75128-2]
49783 [O75128-3]
49784 [O75128-4]
49785 [O75128-5]
49786 [O75128-6]
49787 [O75128-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75128

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75128

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000106078 Expressed in 195 organ(s), highest expression level in globus pallidus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75128 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75128 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019033
HPA019167

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X. Interacts (via WH2 domains) with actin monomers. Interacts with both PACSIN1 and DBNL. Identified in a complex composed of COBL, PACSIN1 and WASL. Interacts with PACSIN1, PACSIN2 and PACSIN3 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116846, 49 interactors

Protein interaction database and analysis system

More...
IntActi
O75128, 38 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378912

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11261
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PL8X-ray2.00H1095-1106[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75128

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1109 – 1129WH2 1PROSITE-ProRule annotationAdd BLAST21
Domaini1149 – 1169WH2 2PROSITE-ProRule annotationAdd BLAST21
Domaini1237 – 1257WH2 3PROSITE-ProRule annotationAdd BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi298 – 303KKRRAP 16
Motifi331 – 336KKRRAP 26

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi22 – 25Poly-Pro4
Compositional biasi303 – 351Pro-richAdd BLAST49
Compositional biasi1021 – 1024Poly-Pro4
Compositional biasi1207 – 1213Poly-Pro7

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJC4 Eukaryota
ENOG410YD9K LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063608

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75128

KEGG Orthology (KO)

More...
KOi
K18623

Identification of Orthologs from Complete Genome Data

More...
OMAi
ITGQFHK

Database of Orthologous Groups

More...
OrthoDBi
986623at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75128

TreeFam database of animal gene trees

More...
TreeFami
TF333490

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039895 COBL-like
IPR019025 Cordon-bleu_ubiquitin_domain
IPR003124 WH2_dom

The PANTHER Classification System

More...
PANTHERi
PTHR47008 PTHR47008, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09469 Cobl, 1 hit
PF02205 WH2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00246 WH2, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51082 WH2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75128-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDAPRASAAK PPTGRKMKAR APPPPGKAAT LHVHSDQKPP HDGALGSQQN
60 70 80 90 100
LVRMKEALRA STMDVTVVLP SGLEKRSVLN GSHAMMDLLV ELCLQNHLNP
110 120 130 140 150
SHHALEIRSS ETQQPLSFKP NTLIGTLNVH TVFLKEKVPE EKVKPGPPKV
160 170 180 190 200
PEKSVRLVVN YLRTQKAVVR VSPEVPLQNI LPVICAKCEV SPEHVVLLRD
210 220 230 240 250
NIAGEELELS KSLNELGIKE LYAWDNRRET FRKSSLGNDE TDKEKKKFLG
260 270 280 290 300
FFKVNKRSNS KGCLTTPNSP SMHSRSLTLG PSLSLGSISG VSVKSEMKKR
310 320 330 340 350
RAPPPPGSGP PVQDKASEKV SLGSQIDLQK KKRRAPAPPP PQPPPPSPLI
360 370 380 390 400
PNRTEDKEEN RKSTMVSLPL GSGSHCSPDG APQVLSEAEE TVSVGSCFAS
410 420 430 440 450
EDTTEDSGVM SSPSDIVSLD SQQDSMKYKD KWATDQEDCS DQDLAGTPDL
460 470 480 490 500
GPQKSPLWEK NGSENSHLRT EKAVTASNDE EDLLIAGEFR KTLAELDEDL
510 520 530 540 550
EEMEDSYETD TSSLTSSIHG ASNHCPQDAM IPHGDTDAIP VTFIGEVSDD
560 570 580 590 600
PVDSGLFSNR NNNAGSFDSE GVASRRDSLA PLQAEHSQPH EKAREEVPAL
610 620 630 640 650
HPASHDVGKG IRVALSNISK DGNLMETAPR VTSFASNLHT DNLNAKVKDK
660 670 680 690 700
VYGCADGERT QATERVNSQP VNEKDSNDKN AALAPTSWHQ RGQNPGKSYR
710 720 730 740 750
LKHGLTTYKI IPPKSEMRCY DRDVSLSTGA IKIDELGNLV SPHATGIRII
760 770 780 790 800
SLSSSVPEAE SQPIGKVREF WRCNSVEKHL GRPSESSARG PPSTPVPTQT
810 820 830 840 850
QNPESRLQAD PKPISPQQKS AHHEGRNPLG EGRNQPPTMG MGHVRVPAAH
860 870 880 890 900
TTEVTFLKPQ RRTSSQYVAS AIAKRIGAPK VHADVVRPHG YAEKGYAGKA
910 920 930 940 950
PVLAAPPVTV KDDRTSSPHS ETQGWKDGAQ WPCVTPPNNH GEDLAVGAPP
960 970 980 990 1000
RGEVIGPHRK LSTQDRPAAI HRSSCFSLVQ SSQRDRVSVG QSCGFSGKQS
1010 1020 1030 1040 1050
TSSQEASSAS EPRRAPDGTD PPPPHTSDTQ ACSRELVNGS VRAPGHGEPS
1060 1070 1080 1090 1100
HPPGGSGTES HILLEREEKP SVFSTDGNET DSIWPPSIFG PKKKFKPVVQ
1110 1120 1130 1140 1150
RPVPKDTSLH SALMEAIHSA GGKDRLRKTA EHTGEGRPAK LSYTEAEGER
1160 1170 1180 1190 1200
SALLAAIRGH SGTCSLRKVA SSASEELQSF RDAALSAQGS ESPLLEDLGL
1210 1220 1230 1240 1250
LSPPAIPPPP PPPSQALSAP RTASRFSTGT LSNTADARQA LMDAIRSGTG
1260
AARLRKVPLL V
Length:1,261
Mass (Da):135,617
Last modified:November 28, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2DA7113EFD343AB3
GO
Isoform 2 (identifier: O75128-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-261: K → KAEQLVLSGADSDEDTSRAAPGRGLN
     366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL

Show »
Length:1,343
Mass (Da):143,928
Checksum:iF195588E26B3D060
GO
Isoform 3 (identifier: O75128-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1169-1215: Missing.

Show »
Length:1,214
Mass (Da):130,883
Checksum:i968E9E2FCC7DAF89
GO
Isoform 4 (identifier: O75128-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-469: SLPLGSGSHC...KNGSENSHLR → YGAAEAVIRL...LAFGRQSLIS
     470-1261: Missing.

Show »
Length:469
Mass (Da):51,195
Checksum:i22AC1B78CDA5253D
GO
Isoform 5 (identifier: O75128-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-379: SLPLGSGSHCSPD → YCCASFPTQAKRF
     380-1261: Missing.

Show »
Length:379
Mass (Da):41,620
Checksum:iB29154E217C991EE
GO
Isoform 6 (identifier: O75128-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-458: Missing.
     459-468: EKNGSENSHL → MSAPFSLVFP

Note: No experimental confirmation available.
Show »
Length:803
Mass (Da):85,849
Checksum:i07D623D2E4A621A3
GO
Isoform 7 (identifier: O75128-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     366-366: V → GGGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVVEPLSFPGEGAGSEASDPIPKL
     1169-1215: Missing.

Show »
Length:1,271
Mass (Da):136,682
Checksum:i4A54B47129EA87A8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KR05J3KR05_HUMAN
Protein cordon-bleu
COBL
1,146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1N2H7C1N2_HUMAN
Protein cordon-bleu
COBL
1,106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J9X1C9J9X1_HUMAN
Protein cordon-bleu
COBL
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YWK3A0A0J9YWK3_HUMAN
Protein cordon-bleu
COBL
394Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IU00A0A3B3IU00_HUMAN
Protein cordon-bleu
COBL
406Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA31608 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti481Missing in AAH29275 (PubMed:15489334).Curated1
Sequence conflicti601H → Y in AAH45771 (PubMed:15489334).Curated1
Sequence conflicti881V → A in AAI44100 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050894526P → L1 PublicationCorresponds to variant dbSNP:rs17656599Ensembl.1
Natural variantiVAR_029043577D → ACombined sources3 PublicationsCorresponds to variant dbSNP:rs10230120Ensembl.1
Natural variantiVAR_029044607V → I3 PublicationsCorresponds to variant dbSNP:rs2240090Ensembl.1
Natural variantiVAR_050895919H → Q1 PublicationCorresponds to variant dbSNP:rs2240089Ensembl.1
Natural variantiVAR_029045927D → N1 PublicationCorresponds to variant dbSNP:rs17134128Ensembl.1
Natural variantiVAR_0290461015A → P1 PublicationCorresponds to variant dbSNP:rs17134127Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0407111 – 458Missing in isoform 6. 1 PublicationAdd BLAST458
Alternative sequenceiVSP_021607261K → KAEQLVLSGADSDEDTSRAA PGRGLN in isoform 2. 1 Publication1
Alternative sequenceiVSP_021608366V → GGGRQVPQKPPRGTARGPPQ LVLPPPPPYPPPDTDVVEPL SFPGEGAGSEASDPIPKL in isoform 2 and isoform 7. 1 Publication1
Alternative sequenceiVSP_021609367 – 469SLPLG…NSHLR → YGAAEAVIRLLSLLLNTTAP GTAKPRTLWMSEGRSSLHNP EIKCSCFSSSSPFPQSLLSL LLGLSSICECMCTLRHTHAH THNPSCVLPTSEILAFGRQS LIS in isoform 4. 1 PublicationAdd BLAST103
Alternative sequenceiVSP_021610367 – 379SLPLG…HCSPD → YCCASFPTQAKRF in isoform 5. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_021611380 – 1261Missing in isoform 5. 1 PublicationAdd BLAST882
Alternative sequenceiVSP_040712459 – 468EKNGSENSHL → MSAPFSLVFP in isoform 6. 1 Publication10
Alternative sequenceiVSP_021612470 – 1261Missing in isoform 4. 1 PublicationAdd BLAST792
Alternative sequenceiVSP_0216131169 – 1215Missing in isoform 3 and isoform 7. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB014533 mRNA Translation: BAA31608.1 Different initiation.
AL713786 mRNA Translation: CAD28543.1
AC005535 Genomic DNA No translation available.
AC012372 Genomic DNA No translation available.
AC004414 Genomic DNA No translation available.
CH236955 Genomic DNA Translation: EAL23896.1
CH471128 Genomic DNA Translation: EAW60962.1
BC029275 mRNA Translation: AAH29275.1
BC045771 mRNA Translation: AAH45771.1
BC094695 mRNA Translation: AAH94695.1
BC111496 mRNA Translation: AAI11497.1
BC136441 mRNA Translation: AAI36442.1
BC144099 mRNA Translation: AAI44100.1
BC150263 mRNA Translation: AAI50264.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34637.1 [O75128-1]
CCDS75601.1 [O75128-5]
CCDS75602.1 [O75128-7]
CCDS87505.1 [O75128-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00381

NCBI Reference Sequences

More...
RefSeqi
NP_001274365.1, NM_001287436.2 [O75128-7]
NP_001274367.1, NM_001287438.2 [O75128-5]
NP_001333370.1, NM_001346441.1
NP_001333371.1, NM_001346442.1 [O75128-3]
NP_001333372.1, NM_001346443.1
NP_001333373.1, NM_001346444.1 [O75128-4]
NP_056013.2, NM_015198.4 [O75128-1]
XP_011513537.1, XM_011515235.1 [O75128-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265136; ENSP00000265136; ENSG00000106078 [O75128-1]
ENST00000395540; ENSP00000378910; ENSG00000106078 [O75128-4]
ENST00000395542; ENSP00000378912; ENSG00000106078 [O75128-7]
ENST00000441453; ENSP00000399500; ENSG00000106078 [O75128-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23242

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23242

UCSC genome browser

More...
UCSCi
uc003tpr.5 human [O75128-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014533 mRNA Translation: BAA31608.1 Different initiation.
AL713786 mRNA Translation: CAD28543.1
AC005535 Genomic DNA No translation available.
AC012372 Genomic DNA No translation available.
AC004414 Genomic DNA No translation available.
CH236955 Genomic DNA Translation: EAL23896.1
CH471128 Genomic DNA Translation: EAW60962.1
BC029275 mRNA Translation: AAH29275.1
BC045771 mRNA Translation: AAH45771.1
BC094695 mRNA Translation: AAH94695.1
BC111496 mRNA Translation: AAI11497.1
BC136441 mRNA Translation: AAI36442.1
BC144099 mRNA Translation: AAI44100.1
BC150263 mRNA Translation: AAI50264.1
CCDSiCCDS34637.1 [O75128-1]
CCDS75601.1 [O75128-5]
CCDS75602.1 [O75128-7]
CCDS87505.1 [O75128-4]
PIRiT00381
RefSeqiNP_001274365.1, NM_001287436.2 [O75128-7]
NP_001274367.1, NM_001287438.2 [O75128-5]
NP_001333370.1, NM_001346441.1
NP_001333371.1, NM_001346442.1 [O75128-3]
NP_001333372.1, NM_001346443.1
NP_001333373.1, NM_001346444.1 [O75128-4]
NP_056013.2, NM_015198.4 [O75128-1]
XP_011513537.1, XM_011515235.1 [O75128-2]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PL8X-ray2.00H1095-1106[»]
SMRiO75128
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116846, 49 interactors
IntActiO75128, 38 interactors
STRINGi9606.ENSP00000378912

PTM databases

iPTMnetiO75128
PhosphoSitePlusiO75128

Polymorphism and mutation databases

BioMutaiCOBL

Proteomic databases

EPDiO75128
jPOSTiO75128
MaxQBiO75128
PaxDbiO75128
PeptideAtlasiO75128
PRIDEiO75128
ProteomicsDBi49781
49782 [O75128-2]
49783 [O75128-3]
49784 [O75128-4]
49785 [O75128-5]
49786 [O75128-6]
49787 [O75128-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265136; ENSP00000265136; ENSG00000106078 [O75128-1]
ENST00000395540; ENSP00000378910; ENSG00000106078 [O75128-4]
ENST00000395542; ENSP00000378912; ENSG00000106078 [O75128-7]
ENST00000441453; ENSP00000399500; ENSG00000106078 [O75128-5]
GeneIDi23242
KEGGihsa:23242
UCSCiuc003tpr.5 human [O75128-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23242
DisGeNETi23242

GeneCards: human genes, protein and diseases

More...
GeneCardsi
COBL
HGNCiHGNC:22199 COBL
HPAiHPA019033
HPA019167
MIMi610317 gene
neXtProtiNX_O75128
OpenTargetsiENSG00000106078
PharmGKBiPA134869580

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJC4 Eukaryota
ENOG410YD9K LUCA
GeneTreeiENSGT00530000063608
InParanoidiO75128
KOiK18623
OMAiITGQFHK
OrthoDBi986623at2759
PhylomeDBiO75128
TreeFamiTF333490

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
COBL human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23242

Protein Ontology

More...
PROi
PR:O75128

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000106078 Expressed in 195 organ(s), highest expression level in globus pallidus
ExpressionAtlasiO75128 baseline and differential
GenevisibleiO75128 HS

Family and domain databases

InterProiView protein in InterPro
IPR039895 COBL-like
IPR019025 Cordon-bleu_ubiquitin_domain
IPR003124 WH2_dom
PANTHERiPTHR47008 PTHR47008, 2 hits
PfamiView protein in Pfam
PF09469 Cobl, 1 hit
PF02205 WH2, 3 hits
SMARTiView protein in SMART
SM00246 WH2, 3 hits
PROSITEiView protein in PROSITE
PS51082 WH2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOBL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75128
Secondary accession number(s): A4D257
, A7E2B0, B7ZLW9, B9EGF8, Q2T9J3, Q504Y4, Q86XA7, Q8N304, Q8TCM1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: May 8, 2019
This is version 131 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again