Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Multiple epidermal growth factor-like domains protein 6

Gene

MEGF6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandCalcium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Multiple epidermal growth factor-like domains protein 6
Short name:
Multiple EGF-like domains protein 6
Alternative name(s):
Epidermal growth factor-like protein 3
Short name:
EGF-like protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MEGF6
Synonyms:EGFL3, KIAA0815
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000162591.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3232 MEGF6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604266 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75095

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000162591

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27665

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MEGF6

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30Sequence analysisAdd BLAST30
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000752431 – 1541Multiple epidermal growth factor-like domains protein 6Add BLAST1511

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi48 ↔ 111Sequence analysis
Disulfide bondi77 ↔ 83Sequence analysis
Disulfide bondi110 ↔ 123Sequence analysis
Disulfide bondi128 ↔ 139By similarity
Disulfide bondi133 ↔ 147By similarity
Disulfide bondi149 ↔ 158By similarity
Disulfide bondi165 ↔ 176By similarity
Disulfide bondi172 ↔ 185By similarity
Disulfide bondi187 ↔ 200By similarity
Disulfide bondi242 ↔ 255By similarity
Disulfide bondi248 ↔ 268By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi252N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi270 ↔ 283By similarity
Disulfide bondi289 ↔ 300By similarity
Disulfide bondi296 ↔ 309By similarity
Disulfide bondi311 ↔ 324By similarity
Disulfide bondi416 ↔ 427By similarity
Disulfide bondi423 ↔ 436By similarity
Disulfide bondi438 ↔ 451By similarity
Disulfide bondi520 ↔ 533By similarity
Disulfide bondi527 ↔ 540By similarity
Disulfide bondi542 ↔ 551By similarity
Disulfide bondi564 ↔ 576By similarity
Disulfide bondi570 ↔ 583By similarity
Disulfide bondi585 ↔ 594By similarity
Disulfide bondi607 ↔ 619By similarity
Disulfide bondi613 ↔ 626By similarity
Disulfide bondi628 ↔ 637By similarity
Glycosylationi739N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi740 ↔ 751By similarity
Disulfide bondi744 ↔ 758By similarity
Disulfide bondi760 ↔ 769By similarity
Disulfide bondi786 ↔ 795By similarity
Disulfide bondi789 ↔ 802By similarity
Disulfide bondi804 ↔ 813By similarity
Disulfide bondi826 ↔ 838By similarity
Disulfide bondi832 ↔ 845By similarity
Disulfide bondi847 ↔ 856By similarity
Disulfide bondi869 ↔ 882By similarity
Disulfide bondi873 ↔ 889By similarity
Disulfide bondi891 ↔ 900By similarity
Disulfide bondi913 ↔ 925By similarity
Disulfide bondi919 ↔ 932By similarity
Disulfide bondi934 ↔ 943By similarity
Disulfide bondi999 ↔ 1011By similarity
Disulfide bondi1005 ↔ 1018By similarity
Disulfide bondi1020 ↔ 1029By similarity
Disulfide bondi1042 ↔ 1054By similarity
Disulfide bondi1048 ↔ 1061By similarity
Disulfide bondi1063 ↔ 1072By similarity
Disulfide bondi1085 ↔ 1097By similarity
Disulfide bondi1091 ↔ 1104By similarity
Disulfide bondi1106 ↔ 1115By similarity
Disulfide bondi1128 ↔ 1140By similarity
Disulfide bondi1134 ↔ 1147By similarity
Disulfide bondi1149 ↔ 1158By similarity
Disulfide bondi1215 ↔ 1227By similarity
Disulfide bondi1221 ↔ 1234By similarity
Disulfide bondi1236 ↔ 1245By similarity
Disulfide bondi1258 ↔ 1270By similarity
Disulfide bondi1264 ↔ 1277By similarity
Disulfide bondi1279 ↔ 1288By similarity
Disulfide bondi1301 ↔ 1313By similarity
Disulfide bondi1307 ↔ 1320By similarity
Disulfide bondi1322 ↔ 1331By similarity
Disulfide bondi1348 ↔ 1356By similarity
Disulfide bondi1350 ↔ 1363By similarity
Disulfide bondi1365 ↔ 1374By similarity
Disulfide bondi1387 ↔ 1399By similarity
Disulfide bondi1393 ↔ 1406By similarity
Disulfide bondi1408 ↔ 1417By similarity
Disulfide bondi1473 ↔ 1485By similarity
Disulfide bondi1479 ↔ 1492By similarity
Disulfide bondi1494 ↔ 1503By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75095

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75095

PeptideAtlas

More...
PeptideAtlasi
O75095

PRoteomics IDEntifications database

More...
PRIDEi
O75095

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49758
49759 [O75095-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75095

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75095

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162591 Expressed in 127 organ(s), highest expression level in descending thoracic aorta

CleanEx database of gene expression profiles

More...
CleanExi
HS_MEGF6

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75095 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75095 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA052129

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108273, 7 interactors

Protein interaction database and analysis system

More...
IntActi
O75095, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000348982

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75095

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75095

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini44 – 125EMIPROSITE-ProRule annotationAdd BLAST82
Domaini124 – 159EGF-like 1PROSITE-ProRule annotationAdd BLAST36
Domaini161 – 201EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini206 – 242EGF-like 3PROSITE-ProRule annotationAdd BLAST37
Domaini238 – 284EGF-like 4PROSITE-ProRule annotationAdd BLAST47
Domaini285 – 325EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini335 – 370EGF-like 6PROSITE-ProRule annotationAdd BLAST36
Domaini375 – 411EGF-like 7PROSITE-ProRule annotationAdd BLAST37
Domaini412 – 452EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini516 – 552EGF-like 9PROSITE-ProRule annotationAdd BLAST37
Domaini560 – 595EGF-like 10PROSITE-ProRule annotationAdd BLAST36
Domaini603 – 638EGF-like 11PROSITE-ProRule annotationAdd BLAST36
Domaini736 – 770EGF-like 12PROSITE-ProRule annotationAdd BLAST35
Domaini783 – 814EGF-like 13PROSITE-ProRule annotationAdd BLAST32
Domaini822 – 857EGF-like 14PROSITE-ProRule annotationAdd BLAST36
Domaini865 – 901EGF-like 15PROSITE-ProRule annotationAdd BLAST37
Domaini909 – 944EGF-like 16PROSITE-ProRule annotationAdd BLAST36
Domaini955 – 987EGF-like 17PROSITE-ProRule annotationAdd BLAST33
Domaini995 – 1030EGF-like 18PROSITE-ProRule annotationAdd BLAST36
Domaini1038 – 1073EGF-like 19PROSITE-ProRule annotationAdd BLAST36
Domaini1081 – 1116EGF-like 20PROSITE-ProRule annotationAdd BLAST36
Domaini1124 – 1159EGF-like 21PROSITE-ProRule annotationAdd BLAST36
Domaini1211 – 1246EGF-like 22PROSITE-ProRule annotationAdd BLAST36
Domaini1254 – 1289EGF-like 23PROSITE-ProRule annotationAdd BLAST36
Domaini1297 – 1332EGF-like 24PROSITE-ProRule annotationAdd BLAST36
Domaini1345 – 1375EGF-like 25PROSITE-ProRule annotationAdd BLAST31
Domaini1383 – 1418EGF-like 26PROSITE-ProRule annotationAdd BLAST36
Domaini1469 – 1504EGF-like 27PROSITE-ProRule annotationAdd BLAST36

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1218 Eukaryota
ENOG410XQWV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156971

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000097840

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG079790

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75095

Identification of Orthologs from Complete Genome Data

More...
OMAi
SCKAGFR

Database of Orthologous Groups

More...
OrthoDBi
25795at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75095

TreeFam database of animal gene trees

More...
TreeFami
TF332598

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR011489 EMI_domain
IPR009030 Growth_fac_rcpt_cys_sf
IPR002049 Laminin_EGF

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07645 EGF_CA, 1 hit
PF12661 hEGF, 5 hits
PF00053 Laminin_EGF, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 31 hits
SM00179 EGF_CA, 8 hits
SM00180 EGF_Lam, 22 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57184 SSF57184, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 4 hits
PS00022 EGF_1, 23 hits
PS01186 EGF_2, 24 hits
PS50026 EGF_3, 23 hits
PS01187 EGF_CA, 4 hits
PS51041 EMI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75095-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSFLEEARAA GRAVVLALVL LLLPAVPVGA SVPPRPLLPL QPGMPHVCAE
60 70 80 90 100
QELTLVGRRQ PCVQALSHTV PVWKAGCGWQ AWCVGHERRT VYYMGYRQVY
110 120 130 140 150
TTEARTVLRC CRGWMQQPDE EGCLSAECSA SLCFHGGRCV PGSAQPCHCP
160 170 180 190 200
PGFQGPRCQY DVDECRTHNG GCQHRCVNTP GSYLCECKPG FRLHTDSRTC
210 220 230 240 250
LAINSCALGN GGCQHHCVQL TITRHRCQCR PGFQLQEDGR HCVRRSPCAN
260 270 280 290 300
RNGSCMHRCQ VVRGLARCEC HVGYQLAADG KACEDVDECA AGLAQCAHGC
310 320 330 340 350
LNTQGSFKCV CHAGYELGAD GRQCYRIEME IVNSCEANNG GCSHGCSHTS
360 370 380 390 400
AGPLCTCPRG YELDTDQRTC IDVDDCADSP CCQQVCTNNP GGYECGCYAG
410 420 430 440 450
YRLSADGCGC EDVDECASSR GGCEHHCTNL AGSFQCSCEA GYRLHEDRRG
460 470 480 490 500
CSPLEEPMVD LDGELPFVRP LPHIAVLQDE LPQLFQDDDV GADEEEAELR
510 520 530 540 550
GEHTLTEKFV CLDDSFGHDC SLTCDDCRNG GTCLLGLDGC DCPEGWTGLI
560 570 580 590 600
CNETCPPDTF GKNCSFSCSC QNGGTCDSVT GACRCPPGVS GTNCEDGCPK
610 620 630 640 650
GYYGKHCRKK CNCANRGRCH RLYGACLCDP GLYGRFCHLT CPPWAFGPGC
660 670 680 690 700
SEECQCVQPH TQSCDKRDGS CSCKAGFRGE RCQAECELGY FGPGCWQACT
710 720 730 740 750
CPVGVACDSV SGECGKRCPA GFQGEDCGQE CPVGTFGVNC SSSCSCGGAP
760 770 780 790 800
CHGVTGQCRC PPGRTGEDCE ADCPEGRWGL GCQEICPACQ HAARCDPETG
810 820 830 840 850
ACLCLPGFVG SRCQDVCPAG WYGPSCQTRC SCANDGHCHP ATGHCSCAPG
860 870 880 890 900
WTGFSCQRAC DTGHWGPDCS HPCNCSAGHG SCDAISGLCL CEAGYVGPRC
910 920 930 940 950
EQQCPQGHFG PGCEQRCQCQ HGAACDHVSG ACTCPAGWRG TFCEHACPAG
960 970 980 990 1000
FFGLDCRSAC NCTAGAACDA VNGSCLCPAG RRGPRCAETC PAHTYGHNCS
1010 1020 1030 1040 1050
QACACFNGAS CDPVHGQCHC APGWMGPSCL QACPAGLYGD NCRHSCLCQN
1060 1070 1080 1090 1100
GGTCDPVSGH CACPEGWAGL ACEKECLPRD VRAGCRHSGG CLNGGLCDPH
1110 1120 1130 1140 1150
TGRCLCPAGW TGDKCQSPCL RGWFGEACAQ RCSCPPGAAC HHVTGACRCP
1160 1170 1180 1190 1200
PGFTGSGCEQ ACPPGSFGED CAQMCQCPGE NPACHPATGT CSCAAGYHGP
1210 1220 1230 1240 1250
SCQQRCPPGR YGPGCEQLCG CLNGGSCDAA TGACRCPTGF LGTDCNLTCP
1260 1270 1280 1290 1300
QGRFGPNCTH VCGCGQGAAC DPVTGTCLCP PGRAGVRCER GCPQNRFGVG
1310 1320 1330 1340 1350
CEHTCSCRNG GLCHASNGSC SCGLGWTGRH CELACPPGRY GAACHLECSC
1360 1370 1380 1390 1400
HNNSTCEPAT GTCRCGPGFY GQACEHPCPP GFHGAGCQGL CWCQHGAPCD
1410 1420 1430 1440 1450
PISGRCLCPA GFHGHFCERG CEPGSFGEGC HQRCDCDGGA PCDPVTGLCL
1460 1470 1480 1490 1500
CPPGRSGATC NLDCRRGQFG PSCTLHCDCG GGADCDPVSG QCHCVDGYMG
1510 1520 1530 1540
PTCREGGPLR LPENPSLAQG SAGTLPASSR PTSRSGGPAR H
Length:1,541
Mass (Da):161,185
Last modified:July 28, 2009 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEF2A7CB65140A7BB
GO
Isoform 2 (identifier: O75095-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-160: Y → MGASRDRGLAALWCLGLLGGLARVAGTHYRYLWRGCYPCHLGQAGYPVSAGDQRP
     989-1075: TCPAHTYGHN...GWAGLACEKE → K
     1161-1205: ACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQR → G
     1377-1454: PCPPGFHGAG...VTGLCLCPPG → R

Note: No experimental confirmation available.
Show »
Length:1,229
Mass (Da):128,614
Checksum:iC01A97596FFC0A8F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C557H7C557_HUMAN
Multiple epidermal growth factor-li...
MEGF6
1,323Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5N9H7C5N9_HUMAN
Multiple epidermal growth factor-li...
MEGF6
248Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA32467 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAE19678 differs from that shown. Reason: Frameshift at position 1522.Curated
The sequence BAE19678 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059258115M → T. Corresponds to variant dbSNP:rs7513275Ensembl.1
Natural variantiVAR_058361131S → G1 PublicationCorresponds to variant dbSNP:rs2794340Ensembl.1
Natural variantiVAR_059259313A → V. Corresponds to variant dbSNP:rs11585362Ensembl.1
Natural variantiVAR_061155587P → L. Corresponds to variant dbSNP:rs947345Ensembl.1
Natural variantiVAR_059260688L → P. Corresponds to variant dbSNP:rs2821008Ensembl.1
Natural variantiVAR_058362916R → L1 PublicationCorresponds to variant dbSNP:rs7553399Ensembl.1
Natural variantiVAR_0583631137G → A1 PublicationCorresponds to variant dbSNP:rs4648506Ensembl.1
Natural variantiVAR_0611561287R → H. Corresponds to variant dbSNP:rs57804877Ensembl.1
Natural variantiVAR_0611571536G → S. Corresponds to variant dbSNP:rs57484147Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0377401 – 159Missing in isoform 2. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_037741160Y → MGASRDRGLAALWCLGLLGG LARVAGTHYRYLWRGCYPCH LGQAGYPVSAGDQRP in isoform 2. 1 Publication1
Alternative sequenceiVSP_037742989 – 1075TCPAH…ACEKE → K in isoform 2. 1 PublicationAdd BLAST87
Alternative sequenceiVSP_0377431161 – 1205ACPPG…SCQQR → G in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0377441377 – 1454PCPPG…LCPPG → R in isoform 2. 1 PublicationAdd BLAST78

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB011539 mRNA Translation: BAA32467.2 Different initiation.
AB231860 mRNA Translation: BAE19678.1 Sequence problems.
AL512413 Genomic DNA No translation available.
AL513320 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41237.1 [O75095-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001400.3, NM_001409.3 [O75095-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.593645

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000294599; ENSP00000294599; ENSG00000162591 [O75095-2]
ENST00000356575; ENSP00000348982; ENSG00000162591 [O75095-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1953

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1953

UCSC genome browser

More...
UCSCi
uc001akk.4 human [O75095-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011539 mRNA Translation: BAA32467.2 Different initiation.
AB231860 mRNA Translation: BAE19678.1 Sequence problems.
AL512413 Genomic DNA No translation available.
AL513320 Genomic DNA No translation available.
CCDSiCCDS41237.1 [O75095-1]
RefSeqiNP_001400.3, NM_001409.3 [O75095-1]
UniGeneiHs.593645

3D structure databases

ProteinModelPortaliO75095
SMRiO75095
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108273, 7 interactors
IntActiO75095, 7 interactors
STRINGi9606.ENSP00000348982

PTM databases

iPTMnetiO75095
PhosphoSitePlusiO75095

Polymorphism and mutation databases

BioMutaiMEGF6

Proteomic databases

jPOSTiO75095
PaxDbiO75095
PeptideAtlasiO75095
PRIDEiO75095
ProteomicsDBi49758
49759 [O75095-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1953
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294599; ENSP00000294599; ENSG00000162591 [O75095-2]
ENST00000356575; ENSP00000348982; ENSG00000162591 [O75095-1]
GeneIDi1953
KEGGihsa:1953
UCSCiuc001akk.4 human [O75095-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1953
EuPathDBiHostDB:ENSG00000162591.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MEGF6

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0000066
HGNCiHGNC:3232 MEGF6
HPAiHPA052129
MIMi604266 gene
neXtProtiNX_O75095
OpenTargetsiENSG00000162591
PharmGKBiPA27665

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1218 Eukaryota
ENOG410XQWV LUCA
GeneTreeiENSGT00940000156971
HOGENOMiHOG000097840
HOVERGENiHBG079790
InParanoidiO75095
OMAiSCKAGFR
OrthoDBi25795at2759
PhylomeDBiO75095
TreeFamiTF332598

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MEGF6 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1953

Protein Ontology

More...
PROi
PR:O75095

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162591 Expressed in 127 organ(s), highest expression level in descending thoracic aorta
CleanExiHS_MEGF6
ExpressionAtlasiO75095 baseline and differential
GenevisibleiO75095 HS

Family and domain databases

InterProiView protein in InterPro
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR011489 EMI_domain
IPR009030 Growth_fac_rcpt_cys_sf
IPR002049 Laminin_EGF
PfamiView protein in Pfam
PF07645 EGF_CA, 1 hit
PF12661 hEGF, 5 hits
PF00053 Laminin_EGF, 5 hits
SMARTiView protein in SMART
SM00181 EGF, 31 hits
SM00179 EGF_CA, 8 hits
SM00180 EGF_Lam, 22 hits
SUPFAMiSSF57184 SSF57184, 3 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 4 hits
PS00022 EGF_1, 23 hits
PS01186 EGF_2, 24 hits
PS50026 EGF_3, 23 hits
PS01187 EGF_CA, 4 hits
PS51041 EMI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMEGF6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75095
Secondary accession number(s): Q4AC86, Q5VV39
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: July 28, 2009
Last modified: January 16, 2019
This is version 145 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again