Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - O75077 (ADA23_HUMAN)

Entry version 165 (25 May 2022)
Sequence version 1 (01 Nov 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Disintegrin and metalloproteinase domain-containing protein 23

Gene

ADAM23

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O75077

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5682910, LGI-ADAM interactions

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O75077

Protein family/group databases

MEROPS protease database

More...MEROPSi		M12.979

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 23
Short name:
ADAM 23
Alternative name(s):
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
Short name:
MDC-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAM23
Synonyms:MDC3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:202, ADAM23

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603710, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O75077

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000114948

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini287 – 792ExtracellularSequence analysisAdd BLAST506
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei793 – 813HelicalSequence analysisAdd BLAST21
Topological domaini814 – 832CytoplasmicSequence analysisAdd BLAST19

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi566E → A: Significantly lower of adhesion-promoting activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		8745

Open Targets

More...OpenTargetsi		ENSG00000114948

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24519

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O75077, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADAM23

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 59Sequence analysisAdd BLAST59
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002911860 – 286Sequence analysisAdd BLAST227
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000029119287 – 832Disintegrin and metalloproteinase domain-containing protein 23Add BLAST546

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi76N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi96N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi100N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi263N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi408 ↔ 491By similarity
Disulfide bondi450 ↔ 475By similarity
Disulfide bondi452 ↔ 459By similarity
Glycosylationi547N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi548N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi560 ↔ 580By similarity
Glycosylationi664N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi732N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi736 ↔ 751By similarity
Disulfide bondi745 ↔ 757By similarity
Disulfide bondi759 ↔ 768By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O75077

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O75077

PeptideAtlas

More...PeptideAtlasi		O75077

PRoteomics IDEntifications database

More...PRIDEi		O75077

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		49740 [O75077-1]
49741 [O75077-2]
49742 [O75077-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O75077, 8 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O75077

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O75077

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O75077

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Highly expressed in the fetal brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000114948, Expressed in middle temporal gyrus and 187 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O75077, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O75077, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000114948, Tissue enhanced (brain, parathyroid gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can bind to LGI1 and LGI4 (By similarity). Ligand for integrin alpha-V/beta-3.

By similarity

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114282, 3 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O75077

Protein interaction database and analysis system

More...IntActi		O75077, 2 interactors

Molecular INTeraction database

More...MINTi		O75077

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000264377

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O75077, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		O75077

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O75077

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini299 – 496Peptidase M12BPROSITE-ProRule annotationAdd BLAST198
Domaini502 – 588DisintegrinPROSITE-ProRule annotationAdd BLAST87
Domaini732 – 769EGF-likePROSITE-ProRule annotationAdd BLAST38

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 37DisorderedSequence analysisAdd BLAST37
Regioni563 – 568May bind the integrin receptor6

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

A conserved motif AVN[ED]CD within the disintegrin-like domain could be involved in the binding to the integrin receptor.

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3607, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158781

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_012714_5_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O75077

Identification of Orthologs from Complete Genome Data

More...OMAi		ECDCTES

Database of Orthologous Groups

More...OrthoDBi		162519at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O75077

TreeFam database of animal gene trees

More...TreeFami		TF314733

Family and domain databases

Conserved Domains Database

More...CDDi		cd04269, ZnMc_adamalysin_II_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.390.10, 1 hit
4.10.70.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006586, ADAM_Cys-rich
IPR001762, Disintegrin_dom
IPR036436, Disintegrin_dom_sf
IPR000742, EGF-like_dom
IPR024079, MetalloPept_cat_dom_sf
IPR001590, Peptidase_M12B
IPR002870, Peptidase_M12B_N
IPR034027, Reprolysin_adamalysin

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08516, ADAM_CR, 1 hit
PF00200, Disintegrin, 1 hit
PF01562, Pep_M12B_propep, 1 hit
PF01421, Reprolysin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00608, ACR, 1 hit
SM00050, DISIN, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57552, SSF57552, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50215, ADAM_MEPRO, 1 hit
PS50214, DISINTEGRIN_2, 1 hit
PS00022, EGF_1, 1 hit
PS50026, EGF_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: O75077-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKPPGSSSRQ PPLAGCSLAG ASCGPQRGPA GSVPASAPAR TPPCRLLLVL 
        60         70         80         90        100
LLLPPLAASS RPRAWGAAAP SAPHWNETAE KNLGVLADED NTLQQNSSSN 
       110        120        130        140        150
ISYSNAMQKE ITLPSRLIYY INQDSESPYH VLDTKARHQQ KHNKAVHLAQ 
       160        170        180        190        200
ASFQIEAFGS KFILDLILNN GLLSSDYVEI HYENGKPQYS KGGEHCYYHG 
       210        220        230        240        250
SIRGVKDSKV ALSTCNGLHG MFEDDTFVYM IEPLELVHDE KSTGRPHIIQ 
       260        270        280        290        300
KTLAGQYSKQ MKNLTMERGD QWPFLSELQW LKRRKRAVNP SRGIFEEMKY 
       310        320        330        340        350
LELMIVNDHK TYKKHRSSHA HTNNFAKSVV NLVDSIYKEQ LNTRVVLVAV 
       360        370        380        390        400
ETWTEKDQID ITTNPVQMLH EFSKYRQRIK QHADAVHLIS RVTFHYKRSS 
       410        420        430        440        450
LSYFGGVCSR TRGVGVNEYG LPMAVAQVLS QSLAQNLGIQ WEPSSRKPKC 
       460        470        480        490        500
DCTESWGGCI MEETGVSHSR KFSKCSILEY RDFLQRGGGA CLFNRPTKLF 
       510        520        530        540        550
EPTECGNGYV EAGEECDCGF HVECYGLCCK KCSLSNGAHC SDGPCCNNTS 
       560        570        580        590        600
CLFQPRGYEC RDAVNECDIT EYCTGDSGQC PPNLHKQDGY ACNQNQGRCY 
       610        620        630        640        650
NGECKTRDNQ CQYIWGTKAA GSDKFCYEKL NTEGTEKGNC GKDGDRWIQC 
       660        670        680        690        700
SKHDVFCGFL LCTNLTRAPR IGQLQGEIIP TSFYHQGRVI DCSGAHVVLD 
       710        720        730        740        750
DDTDVGYVED GTPCGPSMMC LDRKCLQIQA LNMSSCPLDS KGKVCSGHGV 
       760        770        780        790        800
CSNEATCICD FTWAGTDCSI RDPVRNLHPP KDEGPKGPSA TNLIIGSIAG 
       810        820        830 
AILVAAIVLG GTGWGFKNVK KRRFDPTQQG PI
Length:832
Mass (Da):91,926
Last modified:November 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7841A9670E1C24EF
GO
Isoform Beta (identifier: O75077-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-817: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTLLALGVIFGGTGWGIE

Show »
Length:832
Mass (Da):92,046
Checksum:iE388ACE51334052C
GO
Isoform Gamma (identifier: O75077-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     787-832: GPSATNLIIG...RFDPTQQGPI → EMSRREGSIL...AAVLLELLSL

Show »
Length:832
Mass (Da):92,130
Checksum:i7F54A1805FA2EC58
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EWD3E7EWD3_HUMAN
Disintegrin and metalloproteinase d...
ADAM23
832Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2M6H7C2M6_HUMAN
Disintegrin and metalloproteinase d...
ADAM23
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012045787 – 832GPSAT…QQGPI → EMSRREGSILLSKAPSESAA LDGHRLALLDSGYDILAAVL LELLSL in isoform Gamma. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_012046787 – 817GPSAT…GWGFK → VNMATSRLIGAVAGTLLALG VIFGGTGWGIE in isoform Beta. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB009672 mRNA Translation: BAA32351.1
AJ005580 mRNA Translation: CAC20565.1
CH471063 Genomic DNA Translation: EAW70386.1
BC132763 mRNA Translation: AAI32764.1
BC132765 mRNA Translation: AAI32766.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2369.1 [O75077-1]

NCBI Reference Sequences

More...RefSeqi		NP_003803.1, NM_003812.3 [O75077-1]
XP_005246989.1, XM_005246932.3 [O75077-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000264377.8; ENSP00000264377.3; ENSG00000114948.13

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8745

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8745

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000264377.8; ENSP00000264377.3; NM_003812.4; NP_003803.1

UCSC genome browser

More...UCSCi		uc002vbq.6, human [O75077-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009672 mRNA Translation: BAA32351.1
AJ005580 mRNA Translation: CAC20565.1
CH471063 Genomic DNA Translation: EAW70386.1
BC132763 mRNA Translation: AAI32764.1
BC132765 mRNA Translation: AAI32766.1
CCDSiCCDS2369.1 [O75077-1]
RefSeqiNP_003803.1, NM_003812.3 [O75077-1]
XP_005246989.1, XM_005246932.3 [O75077-3]

3D structure databases

AlphaFoldDBiO75077
SMRiO75077
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114282, 3 interactors
CORUMiO75077
IntActiO75077, 2 interactors
MINTiO75077
STRINGi9606.ENSP00000264377

Protein family/group databases

MEROPSiM12.979

PTM databases

GlyGeniO75077, 8 sites
iPTMnetiO75077
PhosphoSitePlusiO75077
SwissPalmiO75077

Genetic variation databases

BioMutaiADAM23

Proteomic databases

MassIVEiO75077
PaxDbiO75077
PeptideAtlasiO75077
PRIDEiO75077
ProteomicsDBi49740 [O75077-1]
49741 [O75077-2]
49742 [O75077-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34180, 245 antibodies from 29 providers

The DNASU plasmid repository

More...DNASUi		8745

Genome annotation databases

EnsembliENST00000264377.8; ENSP00000264377.3; ENSG00000114948.13
GeneIDi8745
KEGGihsa:8745
MANE-SelectiENST00000264377.8; ENSP00000264377.3; NM_003812.4; NP_003803.1
UCSCiuc002vbq.6, human [O75077-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8745
DisGeNETi8745

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADAM23
HGNCiHGNC:202, ADAM23
HPAiENSG00000114948, Tissue enhanced (brain, parathyroid gland)
MIMi603710, gene
neXtProtiNX_O75077
OpenTargetsiENSG00000114948
PharmGKBiPA24519
VEuPathDBiHostDB:ENSG00000114948

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3607, Eukaryota
GeneTreeiENSGT00940000158781
HOGENOMiCLU_012714_5_2_1
InParanoidiO75077
OMAiECDCTES
OrthoDBi162519at2759
PhylomeDBiO75077
TreeFamiTF314733

Enzyme and pathway databases

PathwayCommonsiO75077
ReactomeiR-HSA-5682910, LGI-ADAM interactions
SignaLinkiO75077

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8745, 20 hits in 1070 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ADAM23, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ADAM23

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8745
PharosiO75077, Tbio

Protein Ontology

More...PROi		PR:O75077
RNActiO75077, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000114948, Expressed in middle temporal gyrus and 187 other tissues
ExpressionAtlasiO75077, baseline and differential
GenevisibleiO75077, HS

Family and domain databases

CDDicd04269, ZnMc_adamalysin_II_like, 1 hit
Gene3Di3.40.390.10, 1 hit
4.10.70.10, 1 hit
InterProiView protein in InterPro
IPR006586, ADAM_Cys-rich
IPR001762, Disintegrin_dom
IPR036436, Disintegrin_dom_sf
IPR000742, EGF-like_dom
IPR024079, MetalloPept_cat_dom_sf
IPR001590, Peptidase_M12B
IPR002870, Peptidase_M12B_N
IPR034027, Reprolysin_adamalysin
PfamiView protein in Pfam
PF08516, ADAM_CR, 1 hit
PF00200, Disintegrin, 1 hit
PF01562, Pep_M12B_propep, 1 hit
PF01421, Reprolysin, 1 hit
SMARTiView protein in SMART
SM00608, ACR, 1 hit
SM00050, DISIN, 1 hit
SUPFAMiSSF57552, SSF57552, 1 hit
PROSITEiView protein in PROSITE
PS50215, ADAM_MEPRO, 1 hit
PS50214, DISINTEGRIN_2, 1 hit
PS00022, EGF_1, 1 hit
PS50026, EGF_3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADA23_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75077
Secondary accession number(s): A2RU59
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: November 1, 1998
Last modified: May 25, 2022
This is version 165 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again