Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative tyrosine-protein phosphatase auxilin

Gene

DNAJC6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles. Plays a role in clathrin-mediated endocytosis in neurons (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei164Phosphocysteine intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • clathrin binding Source: GO_Central
  • protein tyrosine phosphatase activity Source: UniProtKB-EC
  • SH3 domain binding Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone, Hydrolase, Protein phosphatase

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-432720 Lysosome Vesicle Biogenesis
R-HSA-432722 Golgi Associated Vesicle Biogenesis
R-HSA-8856828 Clathrin-mediated endocytosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Putative tyrosine-protein phosphatase auxilinCurated (EC:3.1.3.48)
Alternative name(s):
DnaJ homolog subfamily C member 6Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DNAJC6Imported
Synonyms:KIAA0473Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000116675.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15469 DNAJC6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608375 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75061

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Parkinson disease 19A, juvenile-onset (PARK19A)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA juvenile form of Parkinson disease, a complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. PARK19A is characterized by onset of parkinsonian symptoms in the first or second decade of life. Some patients may have additional neurologic features, including mental retardation and seizures.
See also OMIM:615528
Parkinson disease 19B, early-onset (PARK19B)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn early-onset form of Parkinson disease, a complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. PARK19B is characterized by symptoms onset in the third-to-fifth decade, slow disease progression, and prominent. response to dopaminergic therapies. Inheritance is autosomal recessive.
See also OMIM:615528
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_077929870R → G in PARK19B; patient fibroblasts show decreased levels of the protein. 1 PublicationCorresponds to variant dbSNP:rs879255630Ensembl.1

Keywords - Diseasei

Disease mutation, Neurodegeneration, Parkinson disease, Parkinsonism

Organism-specific databases

DisGeNET

More...
DisGeNETi
9829

MalaCards human disease database

More...
MalaCardsi
DNAJC6
MIMi615528 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000116675

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
391411 Atypical juvenile parkinsonism
2828 Young-onset Parkinson disease

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27423

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DNAJC6

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002445161 – 913Putative tyrosine-protein phosphatase auxilinAdd BLAST913

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei112PhosphoserineCombined sources1
Modified residuei453PhosphoserineBy similarity1
Modified residuei456PhosphoserineBy similarity1
Modified residuei563PhosphoserineCombined sources1
Modified residuei570PhosphoserineCombined sources1
Isoform 3 (identifier: O75061-3)
Modified residuei1N-acetylmethionineCombined sources1
Isoform 4 (identifier: O75061-4)
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75061

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75061

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75061

PeptideAtlas

More...
PeptideAtlasi
O75061

PRoteomics IDEntifications database

More...
PRIDEi
O75061

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49731
49732 [O75061-2]
49733 [O75061-3]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
O75061

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75061

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75061

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in various brain regions, including cerebellum, corpus callosum, cortex, striatum, brainstem, pons, putamen, spinal cord and substantia nigra. Very low expression in non-neural tissues such as leukocytes, liver, adipose tissue, skeletal muscle and bone marrow.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116675 Expressed in 162 organ(s), highest expression level in endothelial cell

CleanEx database of gene expression profiles

More...
CleanExi
HS_DNAJC6

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75061 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75061 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA031182
HPA054917

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HSPA8/HSC70. Interacts with CLTC. Interacts with AP2A2 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115167, 21 interactors

Protein interaction database and analysis system

More...
IntActi
O75061, 6 interactors

Molecular INTeraction database

More...
MINTi
O75061

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378735

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75061

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75061

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati36 – 3914
Repeati40 – 4324
Repeati44 – 4734
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini55 – 222Phosphatase tensin-typePROSITE-ProRule annotationAdd BLAST168
Domaini228 – 366C2 tensin-typePROSITE-ProRule annotationAdd BLAST139
Domaini849 – 913JPROSITE-ProRule annotationAdd BLAST65

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni36 – 473 X 4 AA approximate tandem repeatsAdd BLAST12

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi409 – 417SH3-bindingSequence analysis9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi466 – 760Pro-richAdd BLAST295
Compositional biasi529 – 532Poly-Gly4

Keywords - Domaini

Repeat, SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0431 Eukaryota
KOG2283 Eukaryota
ENOG41129H2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158755

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000034235

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004322

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75061

KEGG Orthology (KO)

More...
KOi
K09526

Identification of Orthologs from Complete Genome Data

More...
OMAi
WPSHRRY

Database of Orthologous Groups

More...
OrthoDBi
EOG091G06HJ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75061

TreeFam database of animal gene trees

More...
TreeFami
TF105165

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06257 DnaJ, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.287.110, 1 hit
3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001623 DnaJ_domain
IPR036869 J_dom_sf
IPR029021 Prot-tyrosine_phosphatase-like
IPR014020 Tensin_C2-dom
IPR029023 Tensin_phosphatase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00226 DnaJ, 1 hit
PF10409 PTEN_C2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00271 DnaJ, 1 hit
SM01326 PTEN_C2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46565 SSF46565, 1 hit
SSF52799 SSF52799, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS50076 DNAJ_2, 1 hit
PS51181 PPASE_TENSIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O75061-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKDSENKGAS SPDMEPSYGG GLFDMVKGGA GRLFSNLKDN LKDTLKDTSS
60 70 80 90 100
RVIQSVTSYT KGDLDFTYVT SRIIVMSFPL DNVDIGFRNQ VDDIRSFLDS
110 120 130 140 150
RHLDHYTVYN LSPKSYRTAK FHSRVSECSW PIRQAPSLHN LFAVCRNMYN
160 170 180 190 200
WLLQNPKNVC VVHCLDGRAA SSILVGAMFI FCNLYSTPGP AIRLLYAKRP
210 220 230 240 250
GIGLSPSHRR YLGYMCDLLA DKPYRPHFKP LTIKSITVSP IPFFNKQRNG
260 270 280 290 300
CRPYCDVLIG ETKIYSTCTD FERMKEYRVQ DGKIFIPLNI TVQGDVVVSM
310 320 330 340 350
YHLRSTIGSR LQAKVTNTQI FQLQFHTGFI PLDTTVLKFT KPELDACDVP
360 370 380 390 400
EKYPQLFQVT LDVELQPHDK VIDLTPPWEH YCTKDVNPSI LFSSHQEHQD
410 420 430 440 450
TLALGGQAPI DIPPDNPRHY GQSGFFASLC WQDQKSEKSF CEEDHAALVN
460 470 480 490 500
QESEQSDDEL LTLSSPHGNA NGDKPHGVKK PSKKQQEPAA PPPPEDVDLL
510 520 530 540 550
GLEGSAMSNS FSPPAAPPTN SELLSDLFGG GGAAGPTQAG QSGVEDVFHP
560 570 580 590 600
SGPASTQSTP RRSATSTSAS PTLRVGEGAT FDPFGAPSKP SGQDLLGSFL
610 620 630 640 650
NTSSASSDPF LQPTRSPSPT VHASSTPAVN IQPDVSGGWD WHAKPGGFGM
660 670 680 690 700
GSKSAATSPT GSSHGTPTHQ SKPQTLDPFA DLGTLGSSSF ASKPTTPTGL
710 720 730 740 750
GGGFPPLSSP QKASPQPMGG GWQQGGAYNW QQPQPKPQPS MPHSSPQNRP
760 770 780 790 800
NYNVSFSAMP GGQNERGKGS SNLEGKQKAA DFEDLLSGQG FNAHKDKKGP
810 820 830 840 850
RTIAEMRKEE MAKEMDPEKL KILEWIEGKE RNIRALLSTM HTVLWAGETK
860 870 880 890 900
WKPVGMADLV TPEQVKKVYR KAVLVVHPDK ATGQPYEQYA KMIFMELNDA
910
WSEFENQGQK PLY
Length:913
Mass (Da):99,997
Last modified:June 27, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B7187AAC8ADF2E4
GO
Isoform 2 (identifier: O75061-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MKDSENK → MSLLGSYRKKTSNDGYESLQLVDSNGDLSAGSGGVGGKQRVNAGAAARSPARQPPDRASTMDSS

Show »
Length:970
Mass (Da):105,675
Checksum:iC976C4BB3072DCC7
GO
Isoform 3 (identifier: O75061-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.
     456-913: Missing.

Show »
Length:442
Mass (Da):50,302
Checksum:i5E7AB1E840DADD6A
GO
Isoform 4 (identifier: O75061-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:900
Mass (Da):98,649
Checksum:i6FD4AB1358FF52E9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R305S4R305_HUMAN
Putative tyrosine-protein phosphata...
DNAJC6
516Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA32318 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti178M → V in BAH12344 (PubMed:14702039).Curated1
Sequence conflicti425F → S in AAH51722 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07792476M → L1 PublicationCorresponds to variant dbSNP:rs61757223Ensembl.1
Natural variantiVAR_077925152L → P1 Publication1
Natural variantiVAR_077926264I → V1 Publication1
Natural variantiVAR_077927441C → S1 PublicationCorresponds to variant dbSNP:rs145329294Ensembl.1
Natural variantiVAR_077928562R → C1 PublicationCorresponds to variant dbSNP:rs770127313Ensembl.1
Natural variantiVAR_026908671S → N. Corresponds to variant dbSNP:rs4915691Ensembl.1
Natural variantiVAR_077929870R → G in PARK19B; patient fibroblasts show decreased levels of the protein. 1 PublicationCorresponds to variant dbSNP:rs879255630Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0195791 – 13Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_0195801 – 7MKDSENK → MSLLGSYRKKTSNDGYESLQ LVDSNGDLSAGSGGVGGKQR VNAGAAARSPARQPPDRAST MDSS in isoform 2. 1 Publication7
Alternative sequenceiVSP_019581456 – 913Missing in isoform 3. 1 PublicationAdd BLAST458

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB007942 mRNA Translation: BAA32318.2 Different initiation.
AK296408 mRNA Translation: BAH12344.1
AC119800 Genomic DNA No translation available.
AL139294 Genomic DNA No translation available.
AL355487 Genomic DNA No translation available.
AL356212 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06533.1
CH471059 Genomic DNA Translation: EAX06534.1
CH471059 Genomic DNA Translation: EAX06536.1
CH471059 Genomic DNA Translation: EAX06537.1
BC051722 mRNA Translation: AAH51722.1
BC109279 mRNA Translation: AAI09280.2
BC109280 mRNA Translation: AAI09281.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30739.1 [O75061-1]
CCDS58004.1 [O75061-2]
CCDS58005.1 [O75061-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001243793.1, NM_001256864.1 [O75061-2]
NP_001243794.1, NM_001256865.1 [O75061-4]
NP_055602.1, NM_014787.3 [O75061-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.647643

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263441; ENSP00000263441; ENSG00000116675 [O75061-4]
ENST00000371069; ENSP00000360108; ENSG00000116675 [O75061-2]
ENST00000395325; ENSP00000378735; ENSG00000116675 [O75061-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9829

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9829

UCSC genome browser

More...
UCSCi
uc001dcd.3 human [O75061-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007942 mRNA Translation: BAA32318.2 Different initiation.
AK296408 mRNA Translation: BAH12344.1
AC119800 Genomic DNA No translation available.
AL139294 Genomic DNA No translation available.
AL355487 Genomic DNA No translation available.
AL356212 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06533.1
CH471059 Genomic DNA Translation: EAX06534.1
CH471059 Genomic DNA Translation: EAX06536.1
CH471059 Genomic DNA Translation: EAX06537.1
BC051722 mRNA Translation: AAH51722.1
BC109279 mRNA Translation: AAI09280.2
BC109280 mRNA Translation: AAI09281.2
CCDSiCCDS30739.1 [O75061-1]
CCDS58004.1 [O75061-2]
CCDS58005.1 [O75061-4]
RefSeqiNP_001243793.1, NM_001256864.1 [O75061-2]
NP_001243794.1, NM_001256865.1 [O75061-4]
NP_055602.1, NM_014787.3 [O75061-1]
UniGeneiHs.647643

3D structure databases

ProteinModelPortaliO75061
SMRiO75061
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115167, 21 interactors
IntActiO75061, 6 interactors
MINTiO75061
STRINGi9606.ENSP00000378735

PTM databases

DEPODiO75061
iPTMnetiO75061
PhosphoSitePlusiO75061

Polymorphism and mutation databases

BioMutaiDNAJC6

Proteomic databases

EPDiO75061
MaxQBiO75061
PaxDbiO75061
PeptideAtlasiO75061
PRIDEiO75061
ProteomicsDBi49731
49732 [O75061-2]
49733 [O75061-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263441; ENSP00000263441; ENSG00000116675 [O75061-4]
ENST00000371069; ENSP00000360108; ENSG00000116675 [O75061-2]
ENST00000395325; ENSP00000378735; ENSG00000116675 [O75061-1]
GeneIDi9829
KEGGihsa:9829
UCSCiuc001dcd.3 human [O75061-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9829
DisGeNETi9829
EuPathDBiHostDB:ENSG00000116675.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DNAJC6
HGNCiHGNC:15469 DNAJC6
HPAiHPA031182
HPA054917
MalaCardsiDNAJC6
MIMi608375 gene
615528 phenotype
neXtProtiNX_O75061
OpenTargetsiENSG00000116675
Orphaneti391411 Atypical juvenile parkinsonism
2828 Young-onset Parkinson disease
PharmGKBiPA27423

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0431 Eukaryota
KOG2283 Eukaryota
ENOG41129H2 LUCA
GeneTreeiENSGT00940000158755
HOGENOMiHOG000034235
HOVERGENiHBG004322
InParanoidiO75061
KOiK09526
OMAiWPSHRRY
OrthoDBiEOG091G06HJ
PhylomeDBiO75061
TreeFamiTF105165

Enzyme and pathway databases

ReactomeiR-HSA-432720 Lysosome Vesicle Biogenesis
R-HSA-432722 Golgi Associated Vesicle Biogenesis
R-HSA-8856828 Clathrin-mediated endocytosis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DNAJC6 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Auxilin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9829

Protein Ontology

More...
PROi
PR:O75061

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116675 Expressed in 162 organ(s), highest expression level in endothelial cell
CleanExiHS_DNAJC6
ExpressionAtlasiO75061 baseline and differential
GenevisibleiO75061 HS

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR001623 DnaJ_domain
IPR036869 J_dom_sf
IPR029021 Prot-tyrosine_phosphatase-like
IPR014020 Tensin_C2-dom
IPR029023 Tensin_phosphatase
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
PF10409 PTEN_C2, 1 hit
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SM01326 PTEN_C2, 1 hit
SUPFAMiSSF46565 SSF46565, 1 hit
SSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS50076 DNAJ_2, 1 hit
PS51181 PPASE_TENSIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAUXI_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75061
Secondary accession number(s): B7Z3V8
, D3DQ65, D3DQ66, Q32M66, Q4G0K1, Q5T614, Q5T615
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 27, 2006
Last modified: December 5, 2018
This is version 158 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again