Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plexin-A2

Gene

PLXNA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Coreceptor for SEMA3A and SEMA6A. Necessary for signaling by SEMA6A and class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-399954 Sema3A PAK dependent Axon repulsion
R-HSA-399955 SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
R-HSA-399956 CRMPs in Sema3A signaling
R-HSA-416700 Other semaphorin interactions

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O75051

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O75051

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Plexin-A2
Alternative name(s):
Semaphorin receptor OCT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLXNA2
Synonyms:KIAA0463, OCT, PLXN2
ORF Names:UNQ209/PRO235
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000076356.6

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9100 PLXNA2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601054 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75051

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini35 – 1237ExtracellularSequence analysisAdd BLAST1203
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1238 – 1258HelicalSequence analysisAdd BLAST21
Topological domaini1259 – 1894CytoplasmicSequence analysisAdd BLAST636

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5362

Open Targets

More...
OpenTargetsi
ENSG00000076356

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33426

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLXNA2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 34Sequence analysisAdd BLAST34
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000023274735 – 1894Plexin-A2Add BLAST1860

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi76N-linked (GlcNAc...) asparagine1
Glycosylationi91N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi94 ↔ 103PROSITE-ProRule annotation
Disulfide bondi129 ↔ 137PROSITE-ProRule annotation
Disulfide bondi284 ↔ 405PROSITE-ProRule annotation
Disulfide bondi300 ↔ 356PROSITE-ProRule annotation
Glycosylationi327N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi374 ↔ 393PROSITE-ProRule annotation
Disulfide bondi511 ↔ 528PROSITE-ProRule annotation
Disulfide bondi517 ↔ 559PROSITE-ProRule annotation
Disulfide bondi520 ↔ 537PROSITE-ProRule annotation
Disulfide bondi531 ↔ 543PROSITE-ProRule annotation
Disulfide bondi594 ↔ 613PROSITE-ProRule annotation
Glycosylationi598N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi696N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi756N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1205N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1612PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O75051

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75051

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75051

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75051

PeptideAtlas

More...
PeptideAtlasi
O75051

PRoteomics IDEntifications database

More...
PRIDEi
O75051

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49723
49724 [O75051-2]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
O75051

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75051

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75051

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in fetal brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000076356 Expressed in 202 organ(s), highest expression level in brain

CleanEx database of gene expression profiles

More...
CleanExi
HS_PLXNA2

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75051 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009763

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. The PLXNA2 homodimer interacts with a SEMA6A homodimer, giving rise to a heterotetramer. Interacts directly with NRP1 and NRP2 (By similarity). Interacts with RND1.By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
FynP396883EBI-308264,EBI-524514From Mus musculus.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111376, 46 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O75051

Database of interacting proteins

More...
DIPi
DIP-31672N

Protein interaction database and analysis system

More...
IntActi
O75051, 11 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000356000

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11894
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3Q3JX-ray1.97A1490-1600[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O75051

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75051

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O75051

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 508SemaPROSITE-ProRule annotationAdd BLAST474
Domaini858 – 951IPT/TIG 1Add BLAST94
Domaini954 – 1037IPT/TIG 2Add BLAST84
Domaini1041 – 1139IPT/TIG 3Add BLAST99
Domaini1143 – 1228IPT/TIG 4Add BLAST86

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1261 – 1310Sequence analysisAdd BLAST50

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the plexin family.Curated

Keywords - Domaini

Coiled coil, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IN3A Eukaryota
ENOG410ZA1D LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153318

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG105711

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75051

KEGG Orthology (KO)

More...
KOi
K06820

Identification of Orthologs from Complete Genome Data

More...
OMAi
INISEDC

Database of Orthologous Groups

More...
OrthoDBi
90434at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75051

TreeFam database of animal gene trees

More...
TreeFami
TF312962

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit
2.60.40.10, 6 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR22625 PTHR22625, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 2 hits
PF01403 Sema, 1 hit
PF01833 TIG, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00429 IPT, 4 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 1 hit
SSF81296 SSF81296, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51004 SEMA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O75051-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQRRPWPRA LEVDSRSVVL LSVVWVLLAP PAAGMPQFST FHSENRDWTF
60 70 80 90 100
NHLTVHQGTG AVYVGAINRV YKLTGNLTIQ VAHKTGPEED NKSCYPPLIV
110 120 130 140 150
QPCSEVLTLT NNVNKLLIID YSENRLLACG SLYQGVCKLL RLDDLFILVE
160 170 180 190 200
PSHKKEHYLS SVNKTGTMYG VIVRSEGEDG KLFIGTAVDG KQDYFPTLSS
210 220 230 240 250
RKLPRDPESS AMLDYELHSD FVSSLIKIPS DTLALVSHFD IFYIYGFASG
260 270 280 290 300
GFVYFLTVQP ETPEGVAINS AGDLFYTSRI VRLCKDDPKF HSYVSLPFGC
310 320 330 340 350
TRAGVEYRLL QAAYLAKPGD SLAQAFNITS QDDVLFAIFS KGQKQYHHPP
360 370 380 390 400
DDSALCAFPI RAINLQIKER LQSCYQGEGN LELNWLLGKD VQCTKAPVPI
410 420 430 440 450
DDNFCGLDIN QPLGGSTPVE GLTLYTTSRD RMTSVASYVY NGYSVVFVGT
460 470 480 490 500
KSGKLKKIRA DGPPHGGVQY EMVSVLKDGS PILRDMAFSI DQRYLYVMSE
510 520 530 540 550
RQVTRVPVES CEQYTTCGEC LSSGDPHCGW CALHNMCSRR DKCQQAWEPN
560 570 580 590 600
RFAASISQCV SLAVHPSSIS VSEHSRLLSL VVSDAPDLSA GIACAFGNLT
610 620 630 640 650
EVEGQVSGSQ VICISPGPKD VPVIPLDQDW FGLELQLRSK ETGKIFVSTE
660 670 680 690 700
FKFYNCSAHQ LCLSCVNSAF RCHWCKYRNL CTHDPTTCSF QEGRINISED
710 720 730 740 750
CPQLVPTEEI LIPVGEVKPI TLKARNLPQP QSGQRGYECV LNIQGAIHRV
760 770 780 790 800
PALRFNSSSV QCQNSSYQYD GMDISNLAVD FAVVWNGNFI IDNPQDLKVH
810 820 830 840 850
LYKCAAQRES CGLCLKADRK FECGWCSGER RCTLHQHCTS PSSPWLDWSS
860 870 880 890 900
HNVKCSNPQI TEILTVSGPP EGGTRVTIHG VNLGLDFSEI AHHVQVAGVP
910 920 930 940 950
CTPLPGEYII AEQIVCEMGH ALVGTTSGPV RLCIGECKPE FMTKSHQQYT
960 970 980 990 1000
FVNPSVLSLN PIRGPESGGT MVTITGHYLG AGSSVAVYLG NQTCEFYGRS
1010 1020 1030 1040 1050
MSEIVCVSPP SSNGLGPVPV SVSVDRAHVD SNLQFEYIDD PRVQRIEPEW
1060 1070 1080 1090 1100
SIASGHTPLT ITGFNLDVIQ EPRIRVKFNG KESVNVCKVV NTTTLTCLAP
1110 1120 1130 1140 1150
SLTTDYRPGL DTVERPDEFG FVFNNVQSLL IYNDTKFIYY PNPTFELLSP
1160 1170 1180 1190 1200
TGVLDQKPGS PIILKGKNLC PPASGGAKLN YTVLIGETPC AVTVSETQLL
1210 1220 1230 1240 1250
CEPPNLTGQH KVMVHVGGMV FSPGSVSVIS DSLLTLPAIV SIAAGGSLLL
1260 1270 1280 1290 1300
IIVIIVLIAY KRKSRENDLT LKRLQMQMDN LESRVALECK EAFAELQTDI
1310 1320 1330 1340 1350
NELTSDLDRS GIPYLDYRTY AMRVLFPGIE DHPVLRELEV QGNGQQHVEK
1360 1370 1380 1390 1400
ALKLFAQLIN NKVFLLTFIR TLELQRSFSM RDRGNVASLI MTGLQGRLEY
1410 1420 1430 1440 1450
ATDVLKQLLS DLIDKNLENK NHPKLLLRRT ESVAEKMLTN WFAFLLHKFL
1460 1470 1480 1490 1500
KECAGEPLFM LYCAIKQQME KGPIDAITGE ARYSLSEDKL IRQQIEYKTL
1510 1520 1530 1540 1550
ILNCVNPDNE NSPEIPVKVL NCDTITQVKE KILDAVYKNV PYSQRPRAVD
1560 1570 1580 1590 1600
MDLEWRQGRI ARVVLQDEDI TTKIEGDWKR LNTLMHYQVS DRSVVALVPK
1610 1620 1630 1640 1650
QTSSYNIPAS ASISRTSISR YDSSFRYTGS PDSLRSRAPM ITPDLESGVK
1660 1670 1680 1690 1700
VWHLVKNHDH GDQKEGDRGS KMVSEIYLTR LLATKGTLQK FVDDLFETLF
1710 1720 1730 1740 1750
STVHRGSALP LAIKYMFDFL DEQADRHSIH DTDVRHTWKS NCLPLRFWVN
1760 1770 1780 1790 1800
VIKNPQFVFD IHKGSITDAC LSVVAQTFMD SCSTSEHRLG KDSPSNKLLY
1810 1820 1830 1840 1850
AKDIPSYKSW VERYYADIAK LPAISDQDMN AYLAEQSRLH AVEFNMLSAL
1860 1870 1880 1890
NEIYSYVSKY SEELIGALEQ DEQARRQRLA YKVEQLINAM SIES
Length:1,894
Mass (Da):211,104
Last modified:July 7, 2009 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDFC3DE5BCBB40357
GO
Isoform 2 (identifier: O75051-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGTLGQASLFAPPGNYFWSDHSALCFAESCEGQPGKVEQMSTHRSRLLTAAPLSM
     458-498: IRADGPPHGG...SIDQRYLYVM → VRVYEFRCSN...RQLYFLGEQR
     499-1894: Missing.

Show »
Length:552
Mass (Da):61,649
Checksum:i43B65B3D2C7599BA
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA32308 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti94C → R in AAQ88860 (PubMed:12975309).Curated1
Sequence conflicti599L → P in CAB57275 (PubMed:8570614).Curated1
Sequence conflicti661L → P in CAB57275 (PubMed:8570614).Curated1
Sequence conflicti1085N → V in AAH09343 (PubMed:15489334).Curated1
Sequence conflicti1378F → L in CAB57275 (PubMed:8570614).Curated1
Sequence conflicti1700F → L in AAH09343 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0567225R → Q1 PublicationCorresponds to variant dbSNP:rs2782948Ensembl.1
Natural variantiVAR_05955457Q → R. Corresponds to variant dbSNP:rs11119014Ensembl.1
Natural variantiVAR_059555267A → T. Corresponds to variant dbSNP:rs3748735Ensembl.1
Natural variantiVAR_058201369E → G2 PublicationsCorresponds to variant dbSNP:rs4844658Ensembl.1
Natural variantiVAR_059556805A → G. Corresponds to variant dbSNP:rs17011882Ensembl.1
Natural variantiVAR_0595571443A → T. Corresponds to variant dbSNP:rs12240051Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0179671M → MGTLGQASLFAPPGNYFWSD HSALCFAESCEGQPGKVEQM STHRSRLLTAAPLSM in isoform 2. 1 Publication1
Alternative sequenceiVSP_017968458 – 498IRADG…YLYVM → VRVYEFRCSNAIHLLSKESL LEGSYWWRFNYRQLYFLGEQ R in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_017969499 – 1894Missing in isoform 2. 1 PublicationAdd BLAST1396

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB007932 mRNA Translation: BAA32308.1 Different initiation.
AY358496 mRNA Translation: AAQ88860.1
AL356275 Genomic DNA No translation available.
AL590138 Genomic DNA No translation available.
BC006193 mRNA Translation: AAH06193.2
BC009343 mRNA Translation: AAH09343.2
BC132676 mRNA Translation: AAI32677.2
BC136530 mRNA Translation: AAI36531.1
X87831 mRNA Translation: CAB57275.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31013.1 [O75051-1]

NCBI Reference Sequences

More...
RefSeqi
NP_079455.3, NM_025179.3 [O75051-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.497626

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000367033; ENSP00000356000; ENSG00000076356 [O75051-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5362

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5362

UCSC genome browser

More...
UCSCi
uc001hgz.4 human [O75051-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007932 mRNA Translation: BAA32308.1 Different initiation.
AY358496 mRNA Translation: AAQ88860.1
AL356275 Genomic DNA No translation available.
AL590138 Genomic DNA No translation available.
BC006193 mRNA Translation: AAH06193.2
BC009343 mRNA Translation: AAH09343.2
BC132676 mRNA Translation: AAI32677.2
BC136530 mRNA Translation: AAI36531.1
X87831 mRNA Translation: CAB57275.1
CCDSiCCDS31013.1 [O75051-1]
RefSeqiNP_079455.3, NM_025179.3 [O75051-1]
UniGeneiHs.497626

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3Q3JX-ray1.97A1490-1600[»]
ProteinModelPortaliO75051
SMRiO75051
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111376, 46 interactors
CORUMiO75051
DIPiDIP-31672N
IntActiO75051, 11 interactors
STRINGi9606.ENSP00000356000

PTM databases

CarbonylDBiO75051
iPTMnetiO75051
PhosphoSitePlusiO75051

Polymorphism and mutation databases

BioMutaiPLXNA2

Proteomic databases

EPDiO75051
jPOSTiO75051
MaxQBiO75051
PaxDbiO75051
PeptideAtlasiO75051
PRIDEiO75051
ProteomicsDBi49723
49724 [O75051-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5362
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367033; ENSP00000356000; ENSG00000076356 [O75051-1]
GeneIDi5362
KEGGihsa:5362
UCSCiuc001hgz.4 human [O75051-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5362
DisGeNETi5362
EuPathDBiHostDB:ENSG00000076356.6

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLXNA2
HGNCiHGNC:9100 PLXNA2
HPAiCAB009763
MIMi601054 gene
neXtProtiNX_O75051
OpenTargetsiENSG00000076356
PharmGKBiPA33426

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IN3A Eukaryota
ENOG410ZA1D LUCA
GeneTreeiENSGT00940000153318
HOVERGENiHBG105711
InParanoidiO75051
KOiK06820
OMAiINISEDC
OrthoDBi90434at2759
PhylomeDBiO75051
TreeFamiTF312962

Enzyme and pathway databases

ReactomeiR-HSA-399954 Sema3A PAK dependent Axon repulsion
R-HSA-399955 SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
R-HSA-399956 CRMPs in Sema3A signaling
R-HSA-416700 Other semaphorin interactions
SignaLinkiO75051
SIGNORiO75051

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLXNA2 human
EvolutionaryTraceiO75051

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PLXNA2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5362

Protein Ontology

More...
PROi
PR:O75051

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000076356 Expressed in 202 organ(s), highest expression level in brain
CleanExiHS_PLXNA2
GenevisibleiO75051 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.60.40.10, 6 hits
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR22625 PTHR22625, 1 hit
PfamiView protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 2 hits
PF01403 Sema, 1 hit
PF01833 TIG, 4 hits
SMARTiView protein in SMART
SM00429 IPT, 4 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit
SUPFAMiSSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 1 hit
SSF81296 SSF81296, 4 hits
PROSITEiView protein in PROSITE
PS51004 SEMA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLXA2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75051
Secondary accession number(s): A2RTX9
, B2RMX7, Q6UX61, Q96GN9, Q9BRL1, Q9UIW1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: July 7, 2009
Last modified: January 16, 2019
This is version 148 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again