Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2

Gene

PLCH2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This phospholipase activity is very sensitive to calcium. May be important for formation and maintenance of the neuronal network in the postnatal brain (By similarity).By similarity

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Ca2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei341PROSITE-ProRule annotation1
Metal bindingi342Calcium 1; catalyticBy similarity1
Metal bindingi371Calcium 1; catalyticBy similarity1
Metal bindingi373Calcium 1; catalyticBy similarity1
Active sitei385PROSITE-ProRule annotation1
Metal bindingi420Calcium 1; catalyticBy similarity1
Binding sitei469SubstrateBy similarity1
Binding sitei471SubstrateBy similarity1
Binding sitei653SubstrateBy similarity1
Binding sitei680SubstrateBy similarity1
Metal bindingi784Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi786Calcium 2By similarity1
Metal bindingi810Calcium 2By similarity1
Metal bindingi839Calcium 3By similarity1
Metal bindingi840Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi841Calcium 3By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi182 – 193PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-1855204 Synthesis of IP3 and IP4 in the cytosol

Chemistry databases

SwissLipidsiSLP:000001755

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-eta-2
Phosphoinositide phospholipase C-like 4
Short name:
PLC-L4
Short name:
Phospholipase C-like protein 4
Phospholipase C-eta-2
Short name:
PLC-eta2
Gene namesi
Name:PLCH2
Synonyms:KIAA0450, PLCL4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000149527.17
HGNCiHGNC:29037 PLCH2
MIMi612836 gene
neXtProtiNX_O75038

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000149527
PharmGKBiPA134914471

Polymorphism and mutation databases

BioMutaiPLCH2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000885071 – 14161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2Add BLAST1416

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei487PhosphoserineBy similarity1
Modified residuei491PhosphoserineBy similarity1
Modified residuei595PhosphoserineBy similarity1
Modified residuei605PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiO75038
PeptideAtlasiO75038
PRIDEiO75038
ProteomicsDBi49717
49718 [O75038-2]
49719 [O75038-3]
49720 [O75038-4]
49721 [O75038-5]
TopDownProteomicsiO75038-1 [O75038-1]

PTM databases

iPTMnetiO75038
PhosphoSitePlusiO75038

Expressioni

Tissue specificityi

Expressed in retina and kidney.1 Publication

Gene expression databases

BgeeiENSG00000149527 Expressed in 128 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_PLCH2
ExpressionAtlasiO75038 baseline and differential
GenevisibleiO75038 HS

Organism-specific databases

HPAiHPA072705

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000367747

Structurei

3D structure databases

ProteinModelPortaliO75038
SMRiO75038
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini47 – 155PHPROSITE-ProRule annotationAdd BLAST109
Domaini169 – 204EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini205 – 241EF-hand 2PROSITE-ProRule annotationAdd BLAST37
Domaini326 – 471PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST146
Domaini626 – 740PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST115
Domaini745 – 852C2PROSITE-ProRule annotationAdd BLAST108

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 155Necessary for plasma membrane localizationBy similarityAdd BLAST155

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
GeneTreeiENSGT00760000118936
HOVERGENiHBG107105
InParanoidiO75038
KOiK19006
OMAiQVERCMS
OrthoDBiEOG091G02KH
PhylomeDBiO75038
TreeFamiTF313216

Family and domain databases

Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001192 PI-PLC_fam
IPR028393 PLC-eta2
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336 PTHR10336, 1 hit
PTHR10336:SF145 PTHR10336:SF145, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF09279 EF-hand_like, 1 hit
PF16457 PH_12, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00054 EFh, 2 hits
SM00233 PH, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS50003 PH_DOMAIN, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75038-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGPWPSPDS RTKGTVAWLA EVLLWVGGSV VLSSEWQLGP LVERCMGAMQ
60 70 80 90 100
EGMQMVKLRG GSKGLVRFYY LDEHRSCIRW RPSRKNEKAK ISIDSIQEVS
110 120 130 140 150
EGRQSEVFQR YPDGSFDPNC CFSIYHGSHR ESLDLVSTSS EVARTWVTGL
160 170 180 190 200
RYLMAGISDE DSLARRQRTR DQWLKQTFDE ADKNGDGSLS IGEVLQLLHK
210 220 230 240 250
LNVNLPRQRV KQMFREADTD DHQGTLGFEE FCAFYKMMST RRDLYLLMLT
260 270 280 290 300
YSNHKDHLDA ASLQRFLQVE QKMAGVTLES CQDIIEQFEP CPENKSKGLL
310 320 330 340 350
GIDGFTNYTR SPAGDIFNPE HHHVHQDMTQ PLSHYFITSS HNTYLVGDQL
360 370 380 390 400
MSQSRVDMYA WVLQAGCRCV EVDCWDGPDG EPIVHHGYTL TSKILFKDVI
410 420 430 440 450
ETINKYAFIK NEYPVILSIE NHCSVIQQKK MAQYLTDILG DKLDLSSVSS
460 470 480 490 500
EDATTLPSPQ MLKGKILVKG KKLPANISED AEEGEVSDED SADEIDDDCK
510 520 530 540 550
LLNGDASTNR KRVENTAKRK LDSLIKESKI RDCEDPNNFS VSTLSPSGKL
560 570 580 590 600
GRKSKAEEDV ESGEDAGASR RNGRLVVGSF SRRKKKGSKL KKAASVEEGD
610 620 630 640 650
EGQDSPGGQS RGATRQKKTM KLSRALSDLV KYTKSVATHD IEMEAASSWQ
660 670 680 690 700
VSSFSETKAH QILQQKPAQY LRFNQQQLSR IYPSSYRVDS SNYNPQPFWN
710 720 730 740 750
AGCQMVALNY QSEGRMLQLN RAKFSANGGC GYVLKPGCMC QGVFNPNSED
760 770 780 790 800
PLPGQLKKQL VLRIISGQQL PKPRDSMLGD RGEIIDPFVE VEIIGLPVDC
810 820 830 840 850
SREQTRVVDD NGFNPTWEET LVFMVHMPEI ALVRFLVWDH DPIGRDFIGQ
860 870 880 890 900
RTLAFSSMMP GYRHVYLEGM EEASIFVHVA VSDISGKVKQ ALGLKGLFLR
910 920 930 940 950
GPKPGSLDSH AAGRPPARPS VSQRILRRTA SAPTKSQKPG RRGFPELVLG
960 970 980 990 1000
TRDTGSKGVA DDVVPPGPGP APEAPAQEGP GSGSPRDTRP LSTQRPLPPL
1010 1020 1030 1040 1050
CSLETIAEEP APGPGPPPPA AVPTSSSQGR PPYPTGPGAN VASPLEDTEE
1060 1070 1080 1090 1100
PRDSRPRPCN GEGAGGAYER APGSQTDGRS QPRTLGHLPV IRRVKSEGQV
1110 1120 1130 1140 1150
PTEPLGGWRP LAAPFPAPAV YSDATGSDPL WQRLEPCGHR DSVSSSSSMS
1160 1170 1180 1190 1200
SSDTVIDLSL PSLGLGRSRE NLAGAHMGRL PPRPHSASAA RPDLPPVTKS
1210 1220 1230 1240 1250
KSNPNLRATG QRPPIPDELQ PRSLAPRMAG LPFRPPWGCL SLVGVQDCPV
1260 1270 1280 1290 1300
AAKSKSLGDL TADDFAPSFE GGSRRLSHSL GLPGGTRRVS GPGVRRDTLT
1310 1320 1330 1340 1350
EQLRWLTVFQ QAGDITSPTS LGPAGEGVAG GPGFVRRSSS RSHSRVRAIA
1360 1370 1380 1390 1400
SRARQAQERQ QRLQGLGRQG PPEEERGTPE GACSVGHEGS VDAPAPSKGA
1410
LGPASAAAEN LVLLRL
Length:1,416
Mass (Da):154,668
Last modified:November 13, 2007 - v3
Checksum:i05088ACD9C45AE87
GO
Isoform 2 (identifier: O75038-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPL → MEEPGPPGGLSQDQ
     987-1156: DTRPLSTQRP...SSMSSSDTVI → GKAPAAVAEK...KSPMFSAVRN
     1157-1416: Missing.

Show »
Length:1,129
Mass (Da):124,302
Checksum:iAE28DDFBEE739B2A
GO
Isoform 3 (identifier: O75038-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     706-741: Missing.

Note: No experimental confirmation available.
Show »
Length:1,380
Mass (Da):150,778
Checksum:i7828287338AF8201
GO
Isoform 4 (identifier: O75038-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
     1212-1416: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,211
Mass (Da):132,836
Checksum:i1472D389D2CF4707
GO
Isoform 5 (identifier: O75038-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: Missing.
     117-785: Missing.
     987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
     1212-1416: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:497
Mass (Da):52,942
Checksum:i843420D08D2C3A9F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B9DI82B9DI82_HUMAN
Phosphoinositide phospholipase C
PLCH2
1,239Annotation score:
V9GY64V9GY64_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCH2
111Annotation score:

Sequence cautioni

The sequence AAH43358 differs from that shown. Reason: Frameshift at position 172.Curated
The sequence BAA32295 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC56932 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti559D → E in BAB84975 (Ref. 2) Curated1
Sequence conflicti560V → M in BAB84975 (Ref. 2) Curated1
Isoform 5 (identifier: O75038-5)
Sequence conflicti209Q → L in BAC56932 (Ref. 2) Curated1
Isoform 4 (identifier: O75038-4)
Sequence conflicti1004P → L in BAB84975 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0290671 – 45Missing in isoform 5. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0290681 – 41MSGPW…QLGPL → MEEPGPPGGLSQDQ in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_029069117 – 785Missing in isoform 5. 1 PublicationAdd BLAST669
Alternative sequenceiVSP_029070706 – 741Missing in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_029071987 – 1211DTRPL…RATGQ → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAGKPLLPCVVLPHA PGMAGPGSPAAASAWTVSPR VLVLVALYPWHCLRGTLLPW LACGP in isoform 4 and isoform 5. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_029072987 – 1156DTRPL…SDTVI → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAVRN in isoform 2. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_0290731157 – 1416Missing in isoform 2. 1 PublicationAdd BLAST260
Alternative sequenceiVSP_0290741212 – 1416Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST205

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ176850 mRNA Translation: ABA12209.1
AK074149 mRNA Translation: BAB84975.1
AK122591 mRNA Translation: BAC56932.2 Different initiation.
AB007919 mRNA Translation: BAA32295.3 Different initiation.
AL139246 Genomic DNA No translation available.
BC019679 mRNA Translation: AAH19679.1
BC043358 mRNA Translation: AAH43358.1 Frameshift.
BC050037 mRNA Translation: AAH50037.1
BC128207 mRNA Translation: AAI28208.1
CCDSiCCDS59959.1 [O75038-1]
RefSeqiNP_001289941.1, NM_001303012.1 [O75038-2]
NP_001289942.1, NM_001303013.1
NP_055453.2, NM_014638.3 [O75038-1]
UniGeneiHs.170156

Genome annotation databases

EnsembliENST00000378486; ENSP00000367747; ENSG00000149527 [O75038-1]
ENST00000419816; ENSP00000389803; ENSG00000149527 [O75038-1]
ENST00000449969; ENSP00000397289; ENSG00000149527 [O75038-2]
ENST00000620687; ENSP00000481938; ENSG00000276429 [O75038-1]
ENST00000626246; ENSP00000486186; ENSG00000276429 [O75038-1]
ENST00000627854; ENSP00000487140; ENSG00000276429 [O75038-2]
GeneIDi9651
KEGGihsa:9651
UCSCiuc001ajj.2 human [O75038-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ176850 mRNA Translation: ABA12209.1
AK074149 mRNA Translation: BAB84975.1
AK122591 mRNA Translation: BAC56932.2 Different initiation.
AB007919 mRNA Translation: BAA32295.3 Different initiation.
AL139246 Genomic DNA No translation available.
BC019679 mRNA Translation: AAH19679.1
BC043358 mRNA Translation: AAH43358.1 Frameshift.
BC050037 mRNA Translation: AAH50037.1
BC128207 mRNA Translation: AAI28208.1
CCDSiCCDS59959.1 [O75038-1]
RefSeqiNP_001289941.1, NM_001303012.1 [O75038-2]
NP_001289942.1, NM_001303013.1
NP_055453.2, NM_014638.3 [O75038-1]
UniGeneiHs.170156

3D structure databases

ProteinModelPortaliO75038
SMRiO75038
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000367747

Chemistry databases

SwissLipidsiSLP:000001755

PTM databases

iPTMnetiO75038
PhosphoSitePlusiO75038

Polymorphism and mutation databases

BioMutaiPLCH2

Proteomic databases

PaxDbiO75038
PeptideAtlasiO75038
PRIDEiO75038
ProteomicsDBi49717
49718 [O75038-2]
49719 [O75038-3]
49720 [O75038-4]
49721 [O75038-5]
TopDownProteomicsiO75038-1 [O75038-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000378486; ENSP00000367747; ENSG00000149527 [O75038-1]
ENST00000419816; ENSP00000389803; ENSG00000149527 [O75038-1]
ENST00000449969; ENSP00000397289; ENSG00000149527 [O75038-2]
ENST00000620687; ENSP00000481938; ENSG00000276429 [O75038-1]
ENST00000626246; ENSP00000486186; ENSG00000276429 [O75038-1]
ENST00000627854; ENSP00000487140; ENSG00000276429 [O75038-2]
GeneIDi9651
KEGGihsa:9651
UCSCiuc001ajj.2 human [O75038-1]

Organism-specific databases

CTDi9651
EuPathDBiHostDB:ENSG00000149527.17
GeneCardsiPLCH2
H-InvDBiHIX0000057
HGNCiHGNC:29037 PLCH2
HPAiHPA072705
MIMi612836 gene
neXtProtiNX_O75038
OpenTargetsiENSG00000149527
PharmGKBiPA134914471
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
GeneTreeiENSGT00760000118936
HOVERGENiHBG107105
InParanoidiO75038
KOiK19006
OMAiQVERCMS
OrthoDBiEOG091G02KH
PhylomeDBiO75038
TreeFamiTF313216

Enzyme and pathway databases

ReactomeiR-HSA-1855204 Synthesis of IP3 and IP4 in the cytosol

Miscellaneous databases

ChiTaRSiPLCH2 human
GenomeRNAii9651
PROiPR:O75038
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000149527 Expressed in 128 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_PLCH2
ExpressionAtlasiO75038 baseline and differential
GenevisibleiO75038 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001192 PI-PLC_fam
IPR028393 PLC-eta2
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336 PTHR10336, 1 hit
PTHR10336:SF145 PTHR10336:SF145, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF09279 EF-hand_like, 1 hit
PF16457 PH_12, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00054 EFh, 2 hits
SM00233 PH, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS50003 PH_DOMAIN, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPLCH2_HUMAN
AccessioniPrimary (citable) accession number: O75038
Secondary accession number(s): A2VCM3
, B9DI80, Q3LUA8, Q86XJ2, Q86XU1, Q86YU7, Q8TEH5, Q8WUS6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 13, 2007
Last modified: November 7, 2018
This is version 154 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again