Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 168 (12 Aug 2020)
Sequence version 3 (13 Nov 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2

Gene

PLCH2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This phospholipase activity is very sensitive to calcium. May be important for formation and maintenance of the neuronal network in the postnatal brain (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei341PROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi342Calcium 1; catalyticBy similarity1
Metal bindingi371Calcium 1; catalyticBy similarity1
Metal bindingi373Calcium 1; catalyticBy similarity1
Active sitei385PROSITE-ProRule annotation1
Metal bindingi420Calcium 1; catalyticBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei469SubstrateBy similarity1
Binding sitei471SubstrateBy similarity1
Binding sitei653SubstrateBy similarity1
Binding sitei680SubstrateBy similarity1
Metal bindingi784Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi786Calcium 2By similarity1
Metal bindingi810Calcium 2By similarity1
Metal bindingi839Calcium 3By similarity1
Metal bindingi840Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi841Calcium 3By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi182 – 193PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
O75038

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1855204, Synthesis of IP3 and IP4 in the cytosol

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001755

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-eta-2
Phosphoinositide phospholipase C-like 4
Short name:
PLC-L4
Short name:
Phospholipase C-like protein 4
Phospholipase C-eta-2
Short name:
PLC-eta2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLCH2
Synonyms:KIAA0450, PLCL4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000149527.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29037, PLCH2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612836, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75038

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9651

Open Targets

More...
OpenTargetsi
ENSG00000149527

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134914471

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O75038, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLCH2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000885071 – 14161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2Add BLAST1416

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei487PhosphoserineBy similarity1
Modified residuei491PhosphoserineBy similarity1
Modified residuei595PhosphoserineBy similarity1
Modified residuei605PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75038

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O75038

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75038

PeptideAtlas

More...
PeptideAtlasi
O75038

PRoteomics IDEntifications database

More...
PRIDEi
O75038

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
49717 [O75038-1]
49718 [O75038-2]
49719 [O75038-3]
49720 [O75038-4]
49721 [O75038-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O75038-1 [O75038-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75038

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75038

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in retina and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000149527, Expressed in right hemisphere of cerebellum and 151 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O75038, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75038, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000149527, Tissue enhanced (brain, retina, skin)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
115009, 2 interactors

Protein interaction database and analysis system

More...
IntActi
O75038, 2 interactors

Molecular INTeraction database

More...
MINTi
O75038

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000367747

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O75038, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75038

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini47 – 155PHPROSITE-ProRule annotationAdd BLAST109
Domaini169 – 204EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini205 – 241EF-hand 2PROSITE-ProRule annotationAdd BLAST37
Domaini326 – 471PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST146
Domaini626 – 740PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST115
Domaini740 – 869C2PROSITE-ProRule annotationAdd BLAST130

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 155Necessary for plasma membrane localizationBy similarityAdd BLAST155

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0169, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158374

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002738_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75038

KEGG Orthology (KO)

More...
KOi
K19006

Identification of Orthologs from Complete Genome Data

More...
OMAi
SMQRSVT

Database of Orthologous Groups

More...
OrthoDBi
368239at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75038

TreeFam database of animal gene trees

More...
TreeFami
TF313216

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR001192, PI-PLC_fam
IPR028393, PLC-eta2
IPR017946, PLC-like_Pdiesterase_TIM-brl
IPR015359, PLC_EF-hand-like
IPR000909, PLipase_C_PInositol-sp_X_dom
IPR001711, PLipase_C_Pinositol-sp_Y

The PANTHER Classification System

More...
PANTHERi
PTHR10336, PTHR10336, 1 hit
PTHR10336:SF166, PTHR10336:SF166, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168, C2, 1 hit
PF09279, EF-hand_like, 1 hit
PF16457, PH_12, 1 hit
PF00388, PI-PLC-X, 1 hit
PF00387, PI-PLC-Y, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00390, PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239, C2, 1 hit
SM00054, EFh, 2 hits
SM00233, PH, 1 hit
SM00148, PLCXc, 1 hit
SM00149, PLCYc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473, SSF47473, 1 hit
SSF51695, SSF51695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004, C2, 1 hit
PS00018, EF_HAND_1, 1 hit
PS50222, EF_HAND_2, 2 hits
PS50003, PH_DOMAIN, 1 hit
PS50007, PIPLC_X_DOMAIN, 1 hit
PS50008, PIPLC_Y_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O75038-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGPWPSPDS RTKGTVAWLA EVLLWVGGSV VLSSEWQLGP LVERCMGAMQ
60 70 80 90 100
EGMQMVKLRG GSKGLVRFYY LDEHRSCIRW RPSRKNEKAK ISIDSIQEVS
110 120 130 140 150
EGRQSEVFQR YPDGSFDPNC CFSIYHGSHR ESLDLVSTSS EVARTWVTGL
160 170 180 190 200
RYLMAGISDE DSLARRQRTR DQWLKQTFDE ADKNGDGSLS IGEVLQLLHK
210 220 230 240 250
LNVNLPRQRV KQMFREADTD DHQGTLGFEE FCAFYKMMST RRDLYLLMLT
260 270 280 290 300
YSNHKDHLDA ASLQRFLQVE QKMAGVTLES CQDIIEQFEP CPENKSKGLL
310 320 330 340 350
GIDGFTNYTR SPAGDIFNPE HHHVHQDMTQ PLSHYFITSS HNTYLVGDQL
360 370 380 390 400
MSQSRVDMYA WVLQAGCRCV EVDCWDGPDG EPIVHHGYTL TSKILFKDVI
410 420 430 440 450
ETINKYAFIK NEYPVILSIE NHCSVIQQKK MAQYLTDILG DKLDLSSVSS
460 470 480 490 500
EDATTLPSPQ MLKGKILVKG KKLPANISED AEEGEVSDED SADEIDDDCK
510 520 530 540 550
LLNGDASTNR KRVENTAKRK LDSLIKESKI RDCEDPNNFS VSTLSPSGKL
560 570 580 590 600
GRKSKAEEDV ESGEDAGASR RNGRLVVGSF SRRKKKGSKL KKAASVEEGD
610 620 630 640 650
EGQDSPGGQS RGATRQKKTM KLSRALSDLV KYTKSVATHD IEMEAASSWQ
660 670 680 690 700
VSSFSETKAH QILQQKPAQY LRFNQQQLSR IYPSSYRVDS SNYNPQPFWN
710 720 730 740 750
AGCQMVALNY QSEGRMLQLN RAKFSANGGC GYVLKPGCMC QGVFNPNSED
760 770 780 790 800
PLPGQLKKQL VLRIISGQQL PKPRDSMLGD RGEIIDPFVE VEIIGLPVDC
810 820 830 840 850
SREQTRVVDD NGFNPTWEET LVFMVHMPEI ALVRFLVWDH DPIGRDFIGQ
860 870 880 890 900
RTLAFSSMMP GYRHVYLEGM EEASIFVHVA VSDISGKVKQ ALGLKGLFLR
910 920 930 940 950
GPKPGSLDSH AAGRPPARPS VSQRILRRTA SAPTKSQKPG RRGFPELVLG
960 970 980 990 1000
TRDTGSKGVA DDVVPPGPGP APEAPAQEGP GSGSPRDTRP LSTQRPLPPL
1010 1020 1030 1040 1050
CSLETIAEEP APGPGPPPPA AVPTSSSQGR PPYPTGPGAN VASPLEDTEE
1060 1070 1080 1090 1100
PRDSRPRPCN GEGAGGAYER APGSQTDGRS QPRTLGHLPV IRRVKSEGQV
1110 1120 1130 1140 1150
PTEPLGGWRP LAAPFPAPAV YSDATGSDPL WQRLEPCGHR DSVSSSSSMS
1160 1170 1180 1190 1200
SSDTVIDLSL PSLGLGRSRE NLAGAHMGRL PPRPHSASAA RPDLPPVTKS
1210 1220 1230 1240 1250
KSNPNLRATG QRPPIPDELQ PRSLAPRMAG LPFRPPWGCL SLVGVQDCPV
1260 1270 1280 1290 1300
AAKSKSLGDL TADDFAPSFE GGSRRLSHSL GLPGGTRRVS GPGVRRDTLT
1310 1320 1330 1340 1350
EQLRWLTVFQ QAGDITSPTS LGPAGEGVAG GPGFVRRSSS RSHSRVRAIA
1360 1370 1380 1390 1400
SRARQAQERQ QRLQGLGRQG PPEEERGTPE GACSVGHEGS VDAPAPSKGA
1410
LGPASAAAEN LVLLRL
Length:1,416
Mass (Da):154,668
Last modified:November 13, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i05088ACD9C45AE87
GO
Isoform 2 (identifier: O75038-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPL → MEEPGPPGGLSQDQ
     987-1156: DTRPLSTQRP...SSMSSSDTVI → GKAPAAVAEK...KSPMFSAVRN
     1157-1416: Missing.

Show »
Length:1,129
Mass (Da):124,302
Checksum:iAE28DDFBEE739B2A
GO
Isoform 3 (identifier: O75038-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     706-741: Missing.

Show »
Length:1,380
Mass (Da):150,778
Checksum:i7828287338AF8201
GO
Isoform 4 (identifier: O75038-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
     1212-1416: Missing.

Show »
Length:1,211
Mass (Da):132,836
Checksum:i1472D389D2CF4707
GO
Isoform 5 (identifier: O75038-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: Missing.
     117-785: Missing.
     987-1211: DTRPLSTQRP...SNPNLRATGQ → GKAPAAVAEK...TLLPWLACGP
     1212-1416: Missing.

Show »
Length:497
Mass (Da):52,942
Checksum:i843420D08D2C3A9F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B9DI82B9DI82_HUMAN
Phosphoinositide phospholipase C
PLCH2
1,239Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GY64V9GY64_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCH2
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH43358 differs from that shown. Reason: Frameshift.Curated
The sequence BAA32295 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAC56932 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti559D → E in BAB84975 (Ref. 2) Curated1
Sequence conflicti560V → M in BAB84975 (Ref. 2) Curated1
Isoform 5 (identifier: O75038-5)
Sequence conflicti209Q → L in BAC56932 (Ref. 2) Curated1
Isoform 4 (identifier: O75038-4)
Sequence conflicti1004P → L in BAB84975 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0290671 – 45Missing in isoform 5. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0290681 – 41MSGPW…QLGPL → MEEPGPPGGLSQDQ in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_029069117 – 785Missing in isoform 5. 1 PublicationAdd BLAST669
Alternative sequenceiVSP_029070706 – 741Missing in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_029071987 – 1211DTRPL…RATGQ → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAGKPLLPCVVLPHA PGMAGPGSPAAASAWTVSPR VLVLVALYPWHCLRGTLLPW LACGP in isoform 4 and isoform 5. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_029072987 – 1156DTRPL…SDTVI → GKAPAAVAEKSPVRVRPPRV LDGPGPAGMAATCMKCVVGS CAGVNTGGLQRERPPSPGPA SRQAAIRQQPRARADSLGAP CCGLDPHAIPGRSREAPKGP GAWRQGPGGSGSMSSDSSSP DSPGIPERSPRWPEGACRQP GALQGEMSALFAQKLEEIRS KSPMFSAVRN in isoform 2. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_0290731157 – 1416Missing in isoform 2. 1 PublicationAdd BLAST260
Alternative sequenceiVSP_0290741212 – 1416Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST205

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ176850 mRNA Translation: ABA12209.1
AK074149 mRNA Translation: BAB84975.1
AK122591 mRNA Translation: BAC56932.2 Different initiation.
AB007919 mRNA Translation: BAA32295.3 Different initiation.
AL139246 Genomic DNA No translation available.
BC019679 mRNA Translation: AAH19679.1
BC043358 mRNA Translation: AAH43358.1 Frameshift.
BC050037 mRNA Translation: AAH50037.1
BC128207 mRNA Translation: AAI28208.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS59959.1 [O75038-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001289941.1, NM_001303012.1 [O75038-2]
NP_001289942.1, NM_001303013.1
NP_055453.2, NM_014638.3 [O75038-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000378486; ENSP00000367747; ENSG00000149527 [O75038-1]
ENST00000419816; ENSP00000389803; ENSG00000149527 [O75038-1]
ENST00000449969; ENSP00000397289; ENSG00000149527 [O75038-2]
ENST00000620687; ENSP00000481938; ENSG00000276429 [O75038-1]
ENST00000626246; ENSP00000486186; ENSG00000276429 [O75038-1]
ENST00000627854; ENSP00000487140; ENSG00000276429 [O75038-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9651

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9651

UCSC genome browser

More...
UCSCi
uc001ajj.2, human [O75038-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ176850 mRNA Translation: ABA12209.1
AK074149 mRNA Translation: BAB84975.1
AK122591 mRNA Translation: BAC56932.2 Different initiation.
AB007919 mRNA Translation: BAA32295.3 Different initiation.
AL139246 Genomic DNA No translation available.
BC019679 mRNA Translation: AAH19679.1
BC043358 mRNA Translation: AAH43358.1 Frameshift.
BC050037 mRNA Translation: AAH50037.1
BC128207 mRNA Translation: AAI28208.1
CCDSiCCDS59959.1 [O75038-1]
RefSeqiNP_001289941.1, NM_001303012.1 [O75038-2]
NP_001289942.1, NM_001303013.1
NP_055453.2, NM_014638.3 [O75038-1]

3D structure databases

SMRiO75038
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi115009, 2 interactors
IntActiO75038, 2 interactors
MINTiO75038
STRINGi9606.ENSP00000367747

Chemistry databases

SwissLipidsiSLP:000001755

PTM databases

iPTMnetiO75038
PhosphoSitePlusiO75038

Polymorphism and mutation databases

BioMutaiPLCH2

Proteomic databases

jPOSTiO75038
MassIVEiO75038
PaxDbiO75038
PeptideAtlasiO75038
PRIDEiO75038
ProteomicsDBi49717 [O75038-1]
49718 [O75038-2]
49719 [O75038-3]
49720 [O75038-4]
49721 [O75038-5]
TopDownProteomicsiO75038-1 [O75038-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1163, 21 antibodies

Genome annotation databases

EnsembliENST00000378486; ENSP00000367747; ENSG00000149527 [O75038-1]
ENST00000419816; ENSP00000389803; ENSG00000149527 [O75038-1]
ENST00000449969; ENSP00000397289; ENSG00000149527 [O75038-2]
ENST00000620687; ENSP00000481938; ENSG00000276429 [O75038-1]
ENST00000626246; ENSP00000486186; ENSG00000276429 [O75038-1]
ENST00000627854; ENSP00000487140; ENSG00000276429 [O75038-2]
GeneIDi9651
KEGGihsa:9651
UCSCiuc001ajj.2, human [O75038-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9651
DisGeNETi9651
EuPathDBiHostDB:ENSG00000149527.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLCH2
HGNCiHGNC:29037, PLCH2
HPAiENSG00000149527, Tissue enhanced (brain, retina, skin)
MIMi612836, gene
neXtProtiNX_O75038
OpenTargetsiENSG00000149527
PharmGKBiPA134914471

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0169, Eukaryota
GeneTreeiENSGT00940000158374
HOGENOMiCLU_002738_0_0_1
InParanoidiO75038
KOiK19006
OMAiSMQRSVT
OrthoDBi368239at2759
PhylomeDBiO75038
TreeFamiTF313216

Enzyme and pathway databases

PathwayCommonsiO75038
ReactomeiR-HSA-1855204, Synthesis of IP3 and IP4 in the cytosol

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9651, 2 hits in 849 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLCH2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9651
PharosiO75038, Tbio

Protein Ontology

More...
PROi
PR:O75038
RNActiO75038, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000149527, Expressed in right hemisphere of cerebellum and 151 other tissues
ExpressionAtlasiO75038, baseline and differential
GenevisibleiO75038, HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR001192, PI-PLC_fam
IPR028393, PLC-eta2
IPR017946, PLC-like_Pdiesterase_TIM-brl
IPR015359, PLC_EF-hand-like
IPR000909, PLipase_C_PInositol-sp_X_dom
IPR001711, PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336, PTHR10336, 1 hit
PTHR10336:SF166, PTHR10336:SF166, 1 hit
PfamiView protein in Pfam
PF00168, C2, 1 hit
PF09279, EF-hand_like, 1 hit
PF16457, PH_12, 1 hit
PF00388, PI-PLC-X, 1 hit
PF00387, PI-PLC-Y, 1 hit
PRINTSiPR00390, PHPHLIPASEC
SMARTiView protein in SMART
SM00239, C2, 1 hit
SM00054, EFh, 2 hits
SM00233, PH, 1 hit
SM00148, PLCXc, 1 hit
SM00149, PLCYc, 1 hit
SUPFAMiSSF47473, SSF47473, 1 hit
SSF51695, SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004, C2, 1 hit
PS00018, EF_HAND_1, 1 hit
PS50222, EF_HAND_2, 2 hits
PS50003, PH_DOMAIN, 1 hit
PS50007, PIPLC_X_DOMAIN, 1 hit
PS50008, PIPLC_Y_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCH2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75038
Secondary accession number(s): A2VCM3
, B9DI80, Q3LUA8, Q86XJ2, Q86XU1, Q86YU7, Q8TEH5, Q8WUS6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: November 13, 2007
Last modified: August 12, 2020
This is version 168 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again