Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 171 (18 Sep 2019)
Sequence version 2 (01 Feb 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Kinesin-like protein KIF21B

Gene

KIF21B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plus-end directed microtubule-dependent motor protein which displays processive activity. Is involved in regulation of microtubule dynamics, synapse function and neuronal morphology, including dendritic tree branching and spine formation. Plays a role in lerning and memory. Involved in delivery of gamma-aminobutyric acid (GABA(A)) receptor to cell surface.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi87 – 94ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O75037

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein KIF21B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KIF21B
Synonyms:KIAA0449
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29442 KIF21B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608322 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O75037

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23046

Open Targets

More...
OpenTargetsi
ENSG00000116852

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134925106

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KIF21B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254641 – 1637Kinesin-like protein KIF21BAdd BLAST1637

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei579PhosphoserineBy similarity1
Modified residuei582PhosphothreonineBy similarity1
Modified residuei1149PhosphoserineCombined sources1
Modified residuei1167PhosphoserineCombined sources1
Modified residuei1215PhosphoserineCombined sources1
Modified residuei1237PhosphothreonineCombined sources1
Modified residuei1241PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O75037

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O75037

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O75037

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O75037

PeptideAtlas

More...
PeptideAtlasi
O75037

PRoteomics IDEntifications database

More...
PRIDEi
O75037

ProteomicsDB human proteome resource

More...
ProteomicsDBi
3445
49715 [O75037-1]
49716 [O75037-2]
7261

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O75037

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O75037

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116852 Expressed in 155 organ(s), highest expression level in dorsolateral prefrontal cortex

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O75037 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA027249
HPA027274

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TRIM3; the interaction positively affects motility of KIF21B.

Interacts with GABARAP and GABA(A) receptor subunits: GABRG2, GABRA1 and GABRA2. May interact with GABA(A) receptor subunits: GABRB2 and GABRB3.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116684, 33 interactors

Protein interaction database and analysis system

More...
IntActi
O75037, 37 interactors

Molecular INTeraction database

More...
MINTi
O75037

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000411831

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O75037

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 370Kinesin motorPROSITE-ProRule annotationAdd BLAST363
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1306 – 1343WD 1Add BLAST38
Repeati1346 – 1384WD 2Add BLAST39
Repeati1410 – 1448WD 3Add BLAST39
Repeati1451 – 1493WD 4Add BLAST43
Repeati1502 – 1539WD 5Add BLAST38
Repeati1543 – 1582WD 6Add BLAST40
Repeati1585 – 1622WD 7Add BLAST38

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni400 – 1099Interaction with TRIM3By similarityAdd BLAST700

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili376 – 604Sequence analysisAdd BLAST229
Coiled coili631 – 824Sequence analysisAdd BLAST194
Coiled coili928 – 1016Sequence analysisAdd BLAST89

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0244 Eukaryota
COG5059 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159650

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O75037

KEGG Orthology (KO)

More...
KOi
K10395

Identification of Orthologs from Complete Genome Data

More...
OMAi
VMCLTVN

Database of Orthologous Groups

More...
OrthoDBi
390391at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O75037

TreeFam database of animal gene trees

More...
TreeFami
TF105224

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 2 hits
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24115 PTHR24115, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00225 Kinesin, 1 hit
PF00400 WD40, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00380 KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00129 KISc, 1 hit
SM00320 WD40, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O75037-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGQGDCCVK VAVRIRPQLS KEKIEGCHIC TSVTPGEPQV LLGKDKAFTY
60 70 80 90 100
DFVFDLDTWQ EQIYSTCVSK LIEGCFEGYN ATVLAYGQTG AGKTYTMGTG
110 120 130 140 150
FDMATSEEEQ GIIPRAIAHL FGGIAERKRR AQEQGVAGPE FKVSAQFLEL
160 170 180 190 200
YNEEILDLFD STRDPDTRHR RSNIKIHEDA NGGIYTTGVT SRLIHSQEEL
210 220 230 240 250
IQCLKQGALS RTTASTQMNV QSSRSHAIFT IHLCQMRMCT QPDLVNEAVT
260 270 280 290 300
GLPDGTPPSS EYETLTAKFH FVDLAGSERL KRTGATGERA KEGISINCGL
310 320 330 340 350
LALGNVISAL GDQSKKVVHV PYRDSKLTRL LQDSLGGNSQ TIMIACVSPS
360 370 380 390 400
DRDFMETLNT LKYANRARNI KNKVVVNQDK TSQQISALRA EIARLQMELM
410 420 430 440 450
EYKAGKRVIG EDGAEGYSDL FRENAMLQKE NGALRLRVKA MQEAIDAINN
460 470 480 490 500
RVTQLMSQEA NLLLAKAGDG NEAIGALIQN YIREIEELRT KLLESEAMNE
510 520 530 540 550
SLRRSLSRAS ARSPYSLGAS PAAPAFGGSP ASSMEDASEV IRRAKQDLER
560 570 580 590 600
LKKKEVRQRR KSPEKEAFKK RAKLQQENSE ETDENEAEEE EEERDESGCE
610 620 630 640 650
EEEGREDEDE DSGSEESLVD SDSDPEEKEV NFQADLADLT CEIEIKQKLI
660 670 680 690 700
DELENSQRRL QTLKHQYEEK LILLQNKIRD TQLERDRVLQ NLSTMECYTE
710 720 730 740 750
EKANKIKADY EKRLREMNRD LQKLQAAQKE HARLLKNQSR YERELKKLQA
760 770 780 790 800
EVAEMKKAKV ALMKQMREEQ QRRRLVETKR NREIAQLKKE QRRQEFQIRA
810 820 830 840 850
LESQKRQQEM VLRRKTQEVS ALRRLAKPMS ERVAGRAGLK PPMLDSGAEV
860 870 880 890 900
SASTTSSEAE SGARSVSSIV RQWNRKINHF LGDHPAPTVN GTRPARKKFQ
910 920 930 940 950
KKGASQSFSK AARLKWQSLE RRIIDIVMQR MTIVNLEADM ERLIKKREEL
960 970 980 990 1000
FLLQEALRRK RERLQAESPE EEKGLQELAE EIEVLAANID YINDGITDCQ
1010 1020 1030 1040 1050
ATIVQLEETK EELDSTDTSV VISSCSLAEA RLLLDNFLKA SIDKGLQVAQ
1060 1070 1080 1090 1100
KEAQIRLLEG RLRQTDMAGS SQNHLLLDAL REKAEAHPEL QALIYNVQQE
1110 1120 1130 1140 1150
NGYASTDEEI SEFSEGSFSQ SFTMKGSTSH DDFKFKSEPK LSAQMKAVSA
1160 1170 1180 1190 1200
ECLGPPLDIS TKNITKSLAS LVEIKEDGVG FSVRDPYYRD RVSRTVSLPT
1210 1220 1230 1240 1250
RGSTFPRQSR ATETSPLTRR KSYDRGQPIR STDVGFTPPS SPPTRPRNDR
1260 1270 1280 1290 1300
NVFSRLTSNQ SQGSALDKSD DSDSSLSEVL RGIISPVGGA KGARTAPLQC
1310 1320 1330 1340 1350
VSMAEGHTKP ILCLDATDEL LFTGSKDRSC KMWNLVTGQE IAALKGHPNN
1360 1370 1380 1390 1400
VVSIKYCSHS GLVFSVSTSY IKVWDIRDSA KCIRTLTSSG QVISGDACAA
1410 1420 1430 1440 1450
TSTRAITSAQ GEHQINQIAL SPSGTMLYAA SGNAVRIWEL SRFQPVGKLT
1460 1470 1480 1490 1500
GHIGPVMCLT VTQTASQHDL VVTGSKDHYV KMFELGECVT GTIGPTHNFE
1510 1520 1530 1540 1550
PPHYDGIECL AIQGDILFSG SRDNGIKKWD LDQQELIQQI PNAHKDWVCA
1560 1570 1580 1590 1600
LAFIPGRPML LSACRAGVIK VWNVDNFTPI GEIKGHDSPI NAICTNAKHI
1610 1620 1630
FTASSDCRVK LWNYVPGLTP CLPRRVLAIK GRATTLP
Length:1,637
Mass (Da):182,662
Last modified:February 1, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i792647EA1D909C24
GO
Isoform 2 (identifier: O75037-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1269-1281: Missing.

Note: No experimental confirmation available.
Show »
Length:1,624
Mass (Da):181,270
Checksum:i827B497E8ECAC6A1
GO
Isoform 3 (identifier: O75037-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1269-1281: Missing.
     1607-1636: CRVKLWNYVPGLTPCLPRRVLAIKGRATTL → LTVKFWSVRRLPHSGP

Show »
Length:1,610
Mass (Da):179,754
Checksum:iE65AB888C7F031B9
GO
Isoform 4 (identifier: O75037-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1607-1636: CRVKLWNYVPGLTPCLPRRVLAIKGRATTL → LTVKFWSVRRLPHSGP

Show »
Length:1,623
Mass (Da):181,146
Checksum:i90644A587723C23F
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA32294 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0162171269 – 1281Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_0453331607 – 1636CRVKL…RATTL → LTVKFWSVRRLPHSGP in isoform 3 and isoform 4. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB007918 mRNA Translation: BAA32294.2 Different initiation.
AC099756 Genomic DNA No translation available.
AL358473 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91328.1
BC137281 mRNA Translation: AAI37282.1
BC144557 mRNA Translation: AAI44558.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30965.1 [O75037-2]
CCDS58054.1 [O75037-3]
CCDS58055.1 [O75037-4]
CCDS58056.1 [O75037-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00066

NCBI Reference Sequences

More...
RefSeqi
NP_001239029.1, NM_001252100.1 [O75037-1]
NP_001239031.1, NM_001252102.1 [O75037-4]
NP_001239032.1, NM_001252103.1 [O75037-3]
NP_060066.2, NM_017596.3 [O75037-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000332129; ENSP00000328494; ENSG00000116852 [O75037-2]
ENST00000360529; ENSP00000353724; ENSG00000116852 [O75037-3]
ENST00000422435; ENSP00000411831; ENSG00000116852 [O75037-1]
ENST00000461742; ENSP00000433808; ENSG00000116852 [O75037-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23046

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23046

UCSC genome browser

More...
UCSCi
uc001gvr.3 human [O75037-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007918 mRNA Translation: BAA32294.2 Different initiation.
AC099756 Genomic DNA No translation available.
AL358473 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91328.1
BC137281 mRNA Translation: AAI37282.1
BC144557 mRNA Translation: AAI44558.1
CCDSiCCDS30965.1 [O75037-2]
CCDS58054.1 [O75037-3]
CCDS58055.1 [O75037-4]
CCDS58056.1 [O75037-1]
PIRiT00066
RefSeqiNP_001239029.1, NM_001252100.1 [O75037-1]
NP_001239031.1, NM_001252102.1 [O75037-4]
NP_001239032.1, NM_001252103.1 [O75037-3]
NP_060066.2, NM_017596.3 [O75037-2]

3D structure databases

SMRiO75037
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116684, 33 interactors
IntActiO75037, 37 interactors
MINTiO75037
STRINGi9606.ENSP00000411831

PTM databases

iPTMnetiO75037
PhosphoSitePlusiO75037

Polymorphism and mutation databases

BioMutaiKIF21B

Proteomic databases

jPOSTiO75037
MassIVEiO75037
MaxQBiO75037
PaxDbiO75037
PeptideAtlasiO75037
PRIDEiO75037
ProteomicsDBi3445
49715 [O75037-1]
49716 [O75037-2]
7261

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23046
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332129; ENSP00000328494; ENSG00000116852 [O75037-2]
ENST00000360529; ENSP00000353724; ENSG00000116852 [O75037-3]
ENST00000422435; ENSP00000411831; ENSG00000116852 [O75037-1]
ENST00000461742; ENSP00000433808; ENSG00000116852 [O75037-4]
GeneIDi23046
KEGGihsa:23046
UCSCiuc001gvr.3 human [O75037-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23046
DisGeNETi23046

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KIF21B
HGNCiHGNC:29442 KIF21B
HPAiHPA027249
HPA027274
MIMi608322 gene
neXtProtiNX_O75037
OpenTargetsiENSG00000116852
PharmGKBiPA134925106

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0244 Eukaryota
COG5059 LUCA
GeneTreeiENSGT00940000159650
InParanoidiO75037
KOiK10395
OMAiVMCLTVN
OrthoDBi390391at2759
PhylomeDBiO75037
TreeFamiTF105224

Enzyme and pathway databases

ReactomeiR-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins
SignaLinkiO75037

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KIF21B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23046

Pharos

More...
Pharosi
O75037

Protein Ontology

More...
PROi
PR:O75037

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116852 Expressed in 155 organ(s), highest expression level in dorsolateral prefrontal cortex
GenevisibleiO75037 HS

Family and domain databases

Gene3Di2.130.10.10, 2 hits
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR027640 Kinesin-like_fam
IPR019821 Kinesin_motor_CS
IPR001752 Kinesin_motor_dom
IPR036961 Kinesin_motor_dom_sf
IPR027417 P-loop_NTPase
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR24115 PTHR24115, 1 hit
PfamiView protein in Pfam
PF00225 Kinesin, 1 hit
PF00400 WD40, 4 hits
PRINTSiPR00380 KINESINHEAVY
SMARTiView protein in SMART
SM00129 KISc, 1 hit
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00411 KINESIN_MOTOR_1, 1 hit
PS50067 KINESIN_MOTOR_2, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKI21B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O75037
Secondary accession number(s): B2RP62, B7ZMI0, Q5T4J3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: February 1, 2005
Last modified: September 18, 2019
This is version 171 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again