Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (29 Sep 2021)
Sequence version 1 (01 Aug 1998)
Previous versions | rss
Add a publicationFeedback
Protein

LIM domain-binding protein 1-A

Gene

ldb1a

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.

Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DRE-8939236, RUNX1 regulates transcription of genes involved in differentiation of HSCs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM domain-binding protein 1-A
Short name:
LDB-1-A
Alternative name(s):
LIM domain-binding protein 4
Short name:
LDB-4
Short name:
zLdb4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ldb1a
Synonyms:ldb4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7955 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesDanionidaeDanioninaeDanio
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000437 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Zebrafish Information Network genome database

More...
ZFINi
ZDB-GENE-990415-138, ldb1a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002847741 – 374LIM domain-binding protein 1-AAdd BLAST374

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O73715

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed ubiquitously in the embryo and adult.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSDARG00000010137, Expressed in retina and 35 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O73715, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
7955.ENSDARP00000107739

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O73715

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini299 – 338LIM interaction domain (LID)PROSITE-ProRule annotationAdd BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 24DisorderedSequence analysisAdd BLAST24
Regioni249 – 297DisorderedSequence analysisAdd BLAST49
Regioni322 – 374DisorderedSequence analysisAdd BLAST53

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi268 – 297Polar residuesSequence analysisAdd BLAST30
Compositional biasi337 – 374Polar residuesSequence analysisAdd BLAST38

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LDB family.Sequence analysis

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2181, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005639

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_032597_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O73715

Identification of Orthologs from Complete Genome Data

More...
OMAi
TQFDGAN

Database of Orthologous Groups

More...
OrthoDBi
849287at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O73715

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030167, LDB1
IPR041363, LID
IPR029005, LIM-bd/SEUSS

The PANTHER Classification System

More...
PANTHERi
PTHR10378, PTHR10378, 1 hit
PTHR10378:SF7, PTHR10378:SF7, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17916, LID, 1 hit
PF01803, LIM_bind, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51957, LID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform a1 Publication (identifier: O73715-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLDRDVGPTP MYPPSYMEPG IGRHTPYGNQ TDYRIFELNK RLQNWTEQDC
60 70 80 90 100
DNLWWDAFTT EFFEDDAMLT ITFCLEDGPK RYTIGRTLIP RYFRSIFEGG
110 120 130 140 150
ATELFYVLKH PKESFHNNFV SLDCDQCTMV TQNGKPMFTQ VCVEGRLYLE
160 170 180 190 200
FMFDDMMRIK TWHFSIRQHR EVVPRSILAM HAQDPQMLDQ LSKNITRCGL
210 220 230 240 250
SNSTLNYLRL CVILEPMQEL MSRHKTYSLS PRDCLKTCLF QKWQRMVAPP
260 270 280 290 300
AEPARQAPNK RRKRKMSGGS TMSSGGGNNN NSNSKKKSPA SSFALSSQDV
310 320 330 340 350
MVVGEPTLMG GEFGDEDERL ITRLENTQFD AANGIDDEDS FNSSPTMGTN
360 370
SPWNSKAPSS QQGKNDNPSS QSSQ
Length:374
Mass (Da):42,715
Last modified:August 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBF955A2764C579A8
GO
Isoform b1 Publication (identifier: O73715-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     299-315: DVMVVGEPTLMGGEFGD → DLVGTKTCTVPELEDRS
     316-374: Missing.

Note: Lacks LIM-binding domain.1 Publication
Show »
Length:315
Mass (Da):36,411
Checksum:iD9B588DBF266822C
GO
Isoform c (identifier: O73715-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHQNAAGCACRPVCTYCCSSKSFKLYSPKEPPNGSAFPPFHPGAM
     299-315: DVMVVGEPTLMGGEFGD → DLVGTKTCTVPELEDRS
     316-374: Missing.

Note: Lacks LIM-binding domain.Curated1 Publication
Show »
Length:359
Mass (Da):41,081
Checksum:i1C93EA723D05A0CB
GO
Isoform d (identifier: O73715-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-298: Q → QVP
     299-315: DVMVVGEPTLMGGEFGD → DLVGTKTCTVPELEDRS
     316-374: Missing.

Note: Lacks LIM-binding domain.Curated1 Publication
Show »
Length:317
Mass (Da):36,607
Checksum:i9CF818F15D54DCBC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
O73712O73712_DANRE
LIM domain-binding protein 1-A
ldb1b ldb1a
374Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F1R491F1R491_DANRE
LIM domain-binding protein 1-A
ldb1a
396Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2KIT5A0A0G2KIT5_DANRE
LIM domain-binding protein 1-A
ldb1a
411Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8RV37A0A2R8RV37_DANRE
LIM domain-binding protein 1-A
ldb1a
352Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH84686 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti48Missing in AAH84686 (Ref. 3) Curated1
Sequence conflicti240F → V in AAH97093 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0523301M → MHQNAAGCACRPVCTYCCSS KSFKLYSPKEPPNGSAFPPF HPGAM in isoform c. 1 Publication1
Alternative sequenceiVSP_052331298Q → QVP in isoform d. 1 Publication1
Alternative sequenceiVSP_052332299 – 315DVMVV…GEFGD → DLVGTKTCTVPELEDRS in isoform b, isoform c and isoform d. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_052333316 – 374Missing in isoform b, isoform c and isoform d. 2 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF031378 mRNA Translation: AAC15798.1
AB250382 mRNA Translation: BAE95400.1
BC084686 mRNA Translation: AAH84686.1 Different initiation.
BC097093 mRNA Translation: AAH97093.1

NCBI Reference Sequences

More...
RefSeqi
NP_571391.1, NM_131316.1 [O73715-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSDART00000015773; ENSDARP00000003158; ENSDARG00000010137 [O73715-1]
ENSDART00000150376; ENSDARP00000125601; ENSDARG00000010137 [O73715-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
30579

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dre:30579

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF031378 mRNA Translation: AAC15798.1
AB250382 mRNA Translation: BAE95400.1
BC084686 mRNA Translation: AAH84686.1 Different initiation.
BC097093 mRNA Translation: AAH97093.1
RefSeqiNP_571391.1, NM_131316.1 [O73715-1]

3D structure databases

SMRiO73715
ModBaseiSearch...

Protein-protein interaction databases

STRINGi7955.ENSDARP00000107739

Proteomic databases

PaxDbiO73715

Genome annotation databases

EnsembliENSDART00000015773; ENSDARP00000003158; ENSDARG00000010137 [O73715-1]
ENSDART00000150376; ENSDARP00000125601; ENSDARG00000010137 [O73715-2]
GeneIDi30579
KEGGidre:30579

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
30579
ZFINiZDB-GENE-990415-138, ldb1a

Phylogenomic databases

eggNOGiKOG2181, Eukaryota
GeneTreeiENSGT00390000005639
HOGENOMiCLU_032597_0_0_1
InParanoidiO73715
OMAiTQFDGAN
OrthoDBi849287at2759
PhylomeDBiO73715

Enzyme and pathway databases

ReactomeiR-DRE-8939236, RUNX1 regulates transcription of genes involved in differentiation of HSCs

Miscellaneous databases

Protein Ontology

More...
PROi
PR:O73715

Gene expression databases

BgeeiENSDARG00000010137, Expressed in retina and 35 other tissues
ExpressionAtlasiO73715, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR030167, LDB1
IPR041363, LID
IPR029005, LIM-bd/SEUSS
PANTHERiPTHR10378, PTHR10378, 1 hit
PTHR10378:SF7, PTHR10378:SF7, 1 hit
PfamiView protein in Pfam
PF17916, LID, 1 hit
PF01803, LIM_bind, 1 hit
PROSITEiView protein in PROSITE
PS51957, LID, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLDB1A_DANRE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O73715
Secondary accession number(s): Q1EQX3, Q4V929, Q5XFY5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: August 1, 1998
Last modified: September 29, 2021
This is version 121 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again