Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (02 Jun 2021)
Sequence version 1 (01 Aug 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Voltage-dependent L-type calcium channel subunit alpha-1D

Gene

CACNA1D

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei359Calcium ion selectivity and permeabilityBy similarity1
Sitei726Calcium ion selectivity and permeabilityBy similarity1
Sitei1122Calcium ion selectivity and permeabilityBy similarity1
Sitei1435Calcium ion selectivity and permeabilityBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi1522 – 1533Sequence analysisAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit alpha-1D
Alternative name(s):
CHCACHA1D
Voltage-gated calcium channel subunit alpha Cav1.3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CACNA1D
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiGallus gallus (Chicken)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9031 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000539 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 121CytoplasmicSequence analysisAdd BLAST121
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei122 – 140Helical; Name=S1 of repeat ISequence analysisAdd BLAST19
Topological domaini141 – 158ExtracellularSequence analysisAdd BLAST18
Transmembranei159 – 178Helical; Name=S2 of repeat ISequence analysisAdd BLAST20
Topological domaini179 – 190CytoplasmicSequence analysisAdd BLAST12
Transmembranei191 – 209Helical; Name=S3 of repeat ISequence analysisAdd BLAST19
Topological domaini210 – 230ExtracellularSequence analysisAdd BLAST21
Transmembranei231 – 249Helical; Name=S4 of repeat ISequence analysisAdd BLAST19
Topological domaini250 – 268CytoplasmicSequence analysisAdd BLAST19
Transmembranei269 – 288Helical; Name=S5 of repeat ISequence analysisAdd BLAST20
Topological domaini289 – 376ExtracellularSequence analysisAdd BLAST88
Transmembranei377 – 401Helical; Name=S6 of repeat ISequence analysisAdd BLAST25
Topological domaini402 – 544CytoplasmicSequence analysisAdd BLAST143
Transmembranei545 – 564Helical; Name=S1 of repeat IISequence analysisAdd BLAST20
Topological domaini565 – 579ExtracellularSequence analysisAdd BLAST15
Transmembranei580 – 598Helical; Name=S2 of repeat IISequence analysisAdd BLAST19
Topological domaini599 – 606CytoplasmicSequence analysis8
Transmembranei607 – 625Helical; Name=S3 of repeat IISequence analysisAdd BLAST19
Topological domaini626 – 635ExtracellularSequence analysis10
Transmembranei636 – 654Helical; Name=S4 of repeat IISequence analysisAdd BLAST19
Topological domaini655 – 673CytoplasmicSequence analysisAdd BLAST19
Transmembranei674 – 694Helical; Name=S5 of repeat IISequence analysisAdd BLAST21
Topological domaini695 – 748ExtracellularSequence analysisAdd BLAST54
Transmembranei749 – 773Helical; Name=S6 of repeat IISequence analysisAdd BLAST25
Topological domaini774 – 907CytoplasmicSequence analysisAdd BLAST134
Transmembranei908 – 926Helical; Name=S1 of repeat IIISequence analysisAdd BLAST19
Topological domaini927 – 942ExtracellularSequence analysisAdd BLAST16
Transmembranei943 – 962Helical; Name=S2 of repeat IIISequence analysisAdd BLAST20
Topological domaini963 – 974CytoplasmicSequence analysisAdd BLAST12
Transmembranei975 – 993Helical; Name=S3 of repeat IIISequence analysisAdd BLAST19
Topological domaini994 – 999ExtracellularSequence analysis6
Transmembranei1000 – 1019Helical; Name=S4 of repeat IIISequence analysisAdd BLAST20
Topological domaini1020 – 1038CytoplasmicSequence analysisAdd BLAST19
Transmembranei1039 – 1058Helical; Name=S5 of repeat IIISequence analysisAdd BLAST20
Topological domaini1059 – 1148ExtracellularSequence analysisAdd BLAST90
Transmembranei1149 – 1169Helical; Name=S6 of repeat IIISequence analysisAdd BLAST21
Topological domaini1170 – 1226CytoplasmicSequence analysisAdd BLAST57
Transmembranei1227 – 1245Helical; Name=S1 of repeat IVSequence analysisAdd BLAST19
Topological domaini1246 – 1260ExtracellularSequence analysisAdd BLAST15
Transmembranei1261 – 1280Helical; Name=S2 of repeat IVSequence analysisAdd BLAST20
Topological domaini1281 – 1297CytoplasmicSequence analysisAdd BLAST17
Transmembranei1298 – 1319Helical; Name=S3 of repeat IVSequence analysisAdd BLAST22
Topological domaini1320 – 1342ExtracellularSequence analysisAdd BLAST23
Transmembranei1343 – 1362Helical; Name=S4 of repeat IVSequence analysisAdd BLAST20
Topological domaini1363 – 1381CytoplasmicSequence analysisAdd BLAST19
Transmembranei1382 – 1401Helical; Name=S5 of repeat IVSequence analysisAdd BLAST20
Topological domaini1402 – 1468ExtracellularSequence analysisAdd BLAST67
Transmembranei1469 – 1493Helical; Name=S6 of repeat IVSequence analysisAdd BLAST25
Topological domaini1494 – 2190CytoplasmicSequence analysisAdd BLAST697

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000539371 – 2190Voltage-dependent L-type calcium channel subunit alpha-1DAdd BLAST2190

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi150N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi324N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O73700

PRoteomics IDEntifications database

More...
PRIDEi
O73700

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the basilar papilla of the cochlea.

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O73700, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity (By similarity).

Interacts with RIMBP2.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9031.ENSGALP00000035486

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati108 – 404IAdd BLAST297
Repeati530 – 776IIAdd BLAST247
Repeati894 – 1176IIIAdd BLAST283
Repeati1213 – 1496IVAdd BLAST284

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 44DisorderedSequence analysisAdd BLAST44
Regioni57 – 96DisorderedSequence analysisAdd BLAST40
Regioni424 – 441Binding to the beta subunitBy similarityAdd BLAST18
Regioni478 – 500DisorderedSequence analysisAdd BLAST23
Regioni787 – 869DisorderedSequence analysisAdd BLAST83
Regioni1096 – 1186Dihydropyridine bindingBy similarityAdd BLAST91
Regioni1449 – 1515Dihydropyridine bindingBy similarityAdd BLAST67
Regioni1461 – 1504Phenylalkylamine bindingBy similarityAdd BLAST44
Regioni1736 – 1787DisorderedSequence analysisAdd BLAST52
Regioni1803 – 1833DisorderedSequence analysisAdd BLAST31
Regioni1917 – 1952DisorderedSequence analysisAdd BLAST36
Regioni1995 – 2025DisorderedSequence analysisAdd BLAST31

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 18Polar residuesSequence analysisAdd BLAST18
Compositional biasi26 – 44Polar residuesSequence analysisAdd BLAST19
Compositional biasi59 – 96Polar residuesSequence analysisAdd BLAST38
Compositional biasi787 – 830Basic and acidic residuesSequence analysisAdd BLAST44
Compositional biasi845 – 859Acidic residuesSequence analysisAdd BLAST15
Compositional biasi1917 – 1937Basic and acidic residuesSequence analysisAdd BLAST21

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2301, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154839

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O73700

Database of Orthologous Groups

More...
OrthoDBi
172471at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O73700

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031688, CAC1F_C
IPR031649, GPHH_dom
IPR005821, Ion_trans_dom
IPR005452, LVDCC_a1dsu
IPR014873, VDCC_a1su_IQ
IPR005446, VDCC_L_a1su
IPR002077, VDCCAlpha1
IPR027359, Volt_channel_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08763, Ca_chan_IQ, 1 hit
PF16885, CAC1F_C, 2 hits
PF16905, GPHH, 1 hit
PF00520, Ion_trans, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00167, CACHANNEL
PR01630, LVDCCALPHA1
PR01636, LVDCCALPHA1D

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01062, Ca_chan_IQ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O73700-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQHHQQQQPE QHPEEANYAS STRIPLPGDG PTTQSNSSAP SKQTVLSWQA
60 70 80 90 100
AIDAARQAKA AQNMNTTTAQ PVGSLSQRKR QQYAKSKKQG NTSNSRPPRA
110 120 130 140 150
LFCLSLNNPI RRACISLVEW KPFDIFILLS IFANCVALAV YIPFPEDDSN
160 170 180 190 200
STNHNLEKVE YAFLIIFTVE TFLKIIAYGL LLHPNAYVRN GWNLLDFVIV
210 220 230 240 250
VVGLFSVILE QLTKETEGGS HSGGKPGGFD VKALRAFRVL RPLRLVSGVP
260 270 280 290 300
SLQVVLNSII KAMVPLLHIA LLVLFVIIIY AIIGLELFIG KMHKSCFLID
310 320 330 340 350
SDILVEEDPA PCAFSGNGRQ CVMNGTECKG GWVGPNGGIT NFDNFAFAML
360 370 380 390 400
TVFQCITMEG WTDVLYWVND AIGCEWPWIY FVSLIILGSF FVLNLVLGVL
410 420 430 440 450
SGEFSKEREK AKARGDFQKL REKQQLEEDL KGYLDWITQA EDIDPENDEE
460 470 480 490 500
ADEEGKRNRV TLADLMEEKK KSRLSCFGRS SNKHASMPTS ETESVNTENV
510 520 530 540 550
SGEGENPACC GSLCQTISKS KFSRRWRRWN RFNRRKCRAA VKSVTFYWLV
560 570 580 590 600
IVLVFLNTLT ISSEHYNQPD WLTQIQDIAN KVLLALFTCE MLVKMYSLGL
610 620 630 640 650
QAYFVSLFNR FDCFVVCGGI VETILVELEI MSPLGISVFR CVRLLRIFKV
660 670 680 690 700
TRHWASLSNL VASLLNSMKS IASLLLLLFL FIIIFSLLGM QLFGGKFNFD
710 720 730 740 750
ETQTKRSTFD NFPQALLTVF QILTGEDWNA VMYDGIMAYG GPSSSGMIVC
760 770 780 790 800
IYFIILFICG NYILLNVFLA IAVDNLADAE SLNTAQKEEA EEKERKKNAR
810 820 830 840 850
KESLENKKSE KSEGDQKKPK DSKVTIAEYG EGEDEDKDPY PPCDVPVGED
860 870 880 890 900
EEDEEDEPEV PAGPRPRRIS ELNMKEKITP IPEGSAFFIF SSTNPIRVGC
910 920 930 940 950
HRLINHHIFT NLILVFIMLS SVSLAAEDPI RSHSFRNNIL GYADYVFTSM
960 970 980 990 1000
FTFEIILKMT AFGAFLHKGS FCRNYFNLLD LLVVGVSLVS FGIQSSAISV
1010 1020 1030 1040 1050
VKILRVLRVL RPLRAINRAK GLKHVVQCVF VAIRTIGNIM IVTTLLQFMF
1060 1070 1080 1090 1100
ACIGVQLFKG KFYKCTDEAK QNPEECRGIY IVYKDGDVDN PMVKERVWQN
1110 1120 1130 1140 1150
SDFNFDNVLS AMMALFTVST FEGWPALLYK AIDSNGENVG PVYNYRVEIS
1160 1170 1180 1190 1200
IFFIIYIIII AFFMMNIFVG FVIVTFQEQG EQEYKNCELD KNQRQCVEYA
1210 1220 1230 1240 1250
LKARPLRRYI PKNPYQYKFW YVVNSTGFEY IMFVLIMLNT LCLAMQHYGQ
1260 1270 1280 1290 1300
SKLFNDAMDI MNMVFTGVFT VEMVLKLIAF KPKIFVRKKE RWLGYFSDAW
1310 1320 1330 1340 1350
NTFDSLIVIG SIVDVVLSEA DPKPTETVTT DESGNSEDSA RISITFFRLF
1360 1370 1380 1390 1400
RVMRLVKLLS RGEGIRTLLW TFIKSFQALP YVALLIAMLF FIYAVIGMQV
1410 1420 1430 1440 1450
FGKVAMRDNN QINRNNNFQT FPQAVLLLFR CATGEAWQEI MLACLPGKRC
1460 1470 1480 1490 1500
DPESDYNPGE EYTCGSNFAI IYFISFYMLC AFLIINLFVA VIMDNFDYLT
1510 1520 1530 1540 1550
RDWSILGPHH LDEFKRIWSE YDPEAKGRIK HLDVVTLLRR IQPPLGFGKL
1560 1570 1580 1590 1600
CPHRVACKRL VAMNMPLNSD GTVMFNATLF ALVRTALKIK TEGNLEQANE
1610 1620 1630 1640 1650
ELRAVIKKIW KKTSMKLLDQ VVPPAGDDEV TVGKFYATFL IQDYFRKFKK
1660 1670 1680 1690 1700
RKEQGLVGKY PAKNTTIALQ AGLRTLHDIG PEIRRAISCD LQDDEPEENN
1710 1720 1730 1740 1750
PDEEEEVYKR NGALFGNHIN HISSDRRDSF QQINTTHRPL HVQRPSIPSA
1760 1770 1780 1790 1800
SDTEKNIYPH TGNSVYHNHH NHNSVGKQVP NSTNANLNNA NVSKVVHGKH
1810 1820 1830 1840 1850
ANFGSHEHRS ENGYHSYSRA DHEKRRRPSS RRTRYYETYI RSDSGDGRRP
1860 1870 1880 1890 1900
TICREERDIR DYCNDDHYLG EQEYYSGEEY YEEDSMLSGN RHVYDYHCRH
1910 1920 1930 1940 1950
HCHDSDFERP KGYHHPHGFF EEDDSQTCYD TKRSPRRRLL PPTPASNRRS
1960 1970 1980 1990 2000
SFNFECLRRQ SSQDDIPLSP NFHHRTALPL HLMQQQVMAV AGLDSSKAHK
2010 2020 2030 2040 2050
HSPSRSTRSW ATPPATPPNR DHTPYYTPLI QVDRAESTEH MNGSLPSLHR
2060 2070 2080 2090 2100
SSWYTDDPDI SYRTFTPANL TVPNDFRHKH SDKQRSADSL VEAVLISEGL
2110 2120 2130 2140 2150
GRYAKDPKFV SATKHEIADA CDMTIDEMES AASNLLNGNI SNGTNGDMFP
2160 2170 2180 2190
ILSRQDYELQ DFGPGYSDEE PEPGRYEEDL ADEMICITSL
Length:2,190
Mass (Da):249,344
Last modified:August 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i10680C1CB7708651
GO
Isoform 2 (identifier: O73700-2) [UniParc]FASTAAdd to basket
Also known as: IIIS2

The sequence of this isoform differs from the canonical sequence as follows:
     939-958: ILGYADYVFTSMFTFEIILK → ILGYFDYAFTAIFTVEILLK

Show »
Length:2,190
Mass (Da):249,310
Checksum:i5D51A01A2A9BF021
GO
Isoform 3 (identifier: O73700-3) [UniParc]FASTAAdd to basket
Also known as: IVS3

The sequence of this isoform differs from the canonical sequence as follows:
     1294-1321: GYFSDAWNTFDSLIVIGSIVDVVLSEAD → HYFTDAWNTFDALIVVGSVVDIAITEVN

Show »
Length:2,190
Mass (Da):249,421
Checksum:iFE395DA3FD0C8EB5
GO
Isoform 4 (identifier: O73700-4) [UniParc]FASTAAdd to basket
Also known as: IVS2-IVS3

The sequence of this isoform differs from the canonical sequence as follows:
     1284-1293: Missing.

Show »
Length:2,180
Mass (Da):247,987
Checksum:i6FE40271A0443CB9
GO
Isoform 5 (identifier: O73700-5) [UniParc]FASTAAdd to basket
Also known as: PSE29-31-2

The sequence of this isoform differs from the canonical sequence as follows:
     1671-1705: AGLRTLHDIGPEIRRAISCDLQDDEPEENNPDEEE → VLIAHTAQTPFCSPASKLFPFGAEAWLQRAAGVA
     1706-2190: Missing.

Show »
Length:1,704
Mass (Da):193,135
Checksum:i2DF59DFFAAB1EED9
GO
Isoform 6 (identifier: O73700-6) [UniParc]FASTAAdd to basket
Also known as: PSE29-31-1

The sequence of this isoform differs from the canonical sequence as follows:
     1710-1728: RNGALFGNHINHISSDRRD → VMSEHGYVIFLLCNMSFIE
     1729-2190: Missing.

Show »
Length:1,728
Mass (Da):196,290
Checksum:i4C3D0DC0F94A21D5
GO
Isoform 7 (identifier: O73700-7) [UniParc]FASTAAdd to basket
Also known as: PSE48, 154-1

The sequence of this isoform differs from the canonical sequence as follows:
     1892-1894: HVY → NGP
     1895-2190: Missing.

Show »
Length:1,894
Mass (Da):215,549
Checksum:i19993FAC5A7C58E9
GO
Isoform 8 (identifier: O73700-8) [UniParc]FASTAAdd to basket
Also known as: I-II-loop

The sequence of this isoform differs from the canonical sequence as follows:
     459-484: Missing.

Show »
Length:2,164
Mass (Da):246,341
Checksum:iEB44B49B6163C315
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1D5PY30A0A1D5PY30_CHICK
Voltage-dependent L-type calcium ch...
CACNA1D
2,132Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q2UF34A0A3Q2UF34_CHICK
Voltage-dependent L-type calcium ch...
CACNA1D
2,154Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q2UHE5A0A3Q2UHE5_CHICK
Voltage-dependent L-type calcium ch...
CACNA1D
2,182Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q2U4S5A0A3Q2U4S5_CHICK
Voltage-dependent L-type calcium ch...
CACNA1D
2,173Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q3AT79A0A3Q3AT79_CHICK
Voltage-dependent L-type calcium ch...
CACNA1D
2,169Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000927459 – 484Missing in isoform 8. CuratedAdd BLAST26
Alternative sequenceiVSP_000928939 – 958ILGYA…EIILK → ILGYFDYAFTAIFTVEILLK in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0009291284 – 1293Missing in isoform 4. Curated10
Alternative sequenceiVSP_0009301294 – 1321GYFSD…LSEAD → HYFTDAWNTFDALIVVGSVV DIAITEVN in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0009311671 – 1705AGLRT…PDEEE → VLIAHTAQTPFCSPASKLFP FGAEAWLQRAAGVA in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0009321706 – 2190Missing in isoform 5. 1 PublicationAdd BLAST485
Alternative sequenceiVSP_0009331710 – 1728RNGAL…SDRRD → VMSEHGYVIFLLCNMSFIE in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0009341729 – 2190Missing in isoform 6. 1 PublicationAdd BLAST462
Alternative sequenceiVSP_0009351892 – 1894HVY → NGP in isoform 7. Curated3
Alternative sequenceiVSP_0009361895 – 2190Missing in isoform 7. CuratedAdd BLAST296

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF027602 mRNA Translation: AAC08304.1
AF027603 mRNA Translation: AAC08305.1
AF027604 mRNA Translation: AAC08306.1
AF027605 mRNA Translation: AAC08307.1
AF027606 mRNA Translation: AAC08308.1

NCBI Reference Sequences

More...
RefSeqi
NP_990365.1, NM_205034.2 [O73700-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSGALT00000036264; ENSGALP00000035486; ENSGALG00000005332 [O73700-1]
ENSGALT00000055249; ENSGALP00000043621; ENSGALG00000005332 [O73700-5]
ENSGALT00000073762; ENSGALP00000043479; ENSGALG00000005332 [O73700-3]
ENSGALT00000099292; ENSGALP00000070410; ENSGALG00000005332 [O73700-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
395895

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
gga:395895

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027602 mRNA Translation: AAC08304.1
AF027603 mRNA Translation: AAC08305.1
AF027604 mRNA Translation: AAC08306.1
AF027605 mRNA Translation: AAC08307.1
AF027606 mRNA Translation: AAC08308.1
RefSeqiNP_990365.1, NM_205034.2 [O73700-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000035486

Proteomic databases

PaxDbiO73700
PRIDEiO73700

Genome annotation databases

EnsembliENSGALT00000036264; ENSGALP00000035486; ENSGALG00000005332 [O73700-1]
ENSGALT00000055249; ENSGALP00000043621; ENSGALG00000005332 [O73700-5]
ENSGALT00000073762; ENSGALP00000043479; ENSGALG00000005332 [O73700-3]
ENSGALT00000099292; ENSGALP00000070410; ENSGALG00000005332 [O73700-7]
GeneIDi395895
KEGGigga:395895

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
776

Phylogenomic databases

eggNOGiKOG2301, Eukaryota
GeneTreeiENSGT00940000154839
InParanoidiO73700
OrthoDBi172471at2759
PhylomeDBiO73700

Miscellaneous databases

Protein Ontology

More...
PROi
PR:O73700

Gene expression databases

ExpressionAtlasiO73700, baseline and differential

Family and domain databases

Gene3Di1.20.120.350, 4 hits
InterProiView protein in InterPro
IPR031688, CAC1F_C
IPR031649, GPHH_dom
IPR005821, Ion_trans_dom
IPR005452, LVDCC_a1dsu
IPR014873, VDCC_a1su_IQ
IPR005446, VDCC_L_a1su
IPR002077, VDCCAlpha1
IPR027359, Volt_channel_dom_sf
PfamiView protein in Pfam
PF08763, Ca_chan_IQ, 1 hit
PF16885, CAC1F_C, 2 hits
PF16905, GPHH, 1 hit
PF00520, Ion_trans, 4 hits
PRINTSiPR00167, CACHANNEL
PR01630, LVDCCALPHA1
PR01636, LVDCCALPHA1D
SMARTiView protein in SMART
SM01062, Ca_chan_IQ, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAC1D_CHICK
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O73700
Secondary accession number(s): O73701
, O73702, O73703, O73704
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: August 1, 1998
Last modified: June 2, 2021
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again