Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysine-specific demethylase 6A

Gene

Kdm6a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitant with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A (By similarity). Plays a demethylase-independent role in chromatin remodeling to regulate T-box family member-dependent gene expression (PubMed:21095589).By similarity1 Publication

Miscellaneous

Escapes X chromosome inactivation.

Cofactori

Protein has several cofactor binding sites:

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi1146IronBy similarity1
Metal bindingi1148IronBy similarity1
Metal bindingi1226IronBy similarity1
Metal bindingi1331ZincBy similarity1
Metal bindingi1334ZincBy similarity1
Metal bindingi1358ZincBy similarity1
Metal bindingi1361ZincBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-3214842 HDMs demethylate histones

Names & Taxonomyi

Protein namesi
Recommended name:
Lysine-specific demethylase 6A (EC:1.14.11.-)
Alternative name(s):
Histone demethylase UTX
Ubiquitously transcribed TPR protein on the X chromosome
Ubiquitously transcribed X chromosome tetratricopeptide repeat protein
Gene namesi
Name:Kdm6a
Synonyms:Utx
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:1095419 Kdm6a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001064101 – 1401Lysine-specific demethylase 6AAdd BLAST1401

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei519Omega-N-methylarginineCombined sources1
Modified residuei549Omega-N-methylarginineCombined sources1
Modified residuei769PhosphoserineCombined sources1
Modified residuei827PhosphothreonineCombined sources1
Modified residuei829PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiO70546
MaxQBiO70546
PaxDbiO70546
PeptideAtlasiO70546
PRIDEiO70546

PTM databases

iPTMnetiO70546
PhosphoSitePlusiO70546

Expressioni

Tissue specificityi

Expressed in brain, heart and spleen.

Developmental stagei

Widely expressed at E13.5.

Gene expression databases

BgeeiENSMUSG00000037369 Expressed in 283 organ(s), highest expression level in primary oocyte
ExpressionAtlasiO70546 baseline and differential
GenevisibleiO70546 MM

Interactioni

Subunit structurei

Component of the MLL2/3 complex (also named ASCOM complex), at least composed of KMT2D/MLL2 or KMT2C/MLL3, ASH2L, RBBP5, WDR5, NCOA6, DPY30, KDM6A (or KDM6B), PAXIP1/PTIP, PAGR1 and alpha- and beta-tubulin (By similarity). Interacts with TLE1 (PubMed:9854018). Interacts with SUPT6H (PubMed:23503590). Interacts with SMARCA4 (PubMed:21095589).By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Six4Q613212EBI-1573712,EBI-986524

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204471, 4 interactors
IntActiO70546, 6 interactors
MINTiO70546
STRINGi10090.ENSMUSP00000061539

Structurei

3D structure databases

ProteinModelPortaliO70546
SMRiO70546
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati95 – 128TPR 1Add BLAST34
Repeati132 – 165TPR 2Add BLAST34
Repeati169 – 203TPR 3Add BLAST35
Repeati207 – 240TPR 4Add BLAST34
Repeati245 – 285TPR 5Add BLAST41
Repeati286 – 319TPR 6Add BLAST34
Repeati321 – 353TPR 7Add BLAST33
Repeati355 – 387TPR 8Add BLAST33
Domaini1095 – 1258JmjCPROSITE-ProRule annotationAdd BLAST164

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 1095Interaction with SUPT6H1 PublicationAdd BLAST1095

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi9 – 19Poly-AlaAdd BLAST11
Compositional biasi919 – 941Pro-richAdd BLAST23

Sequence similaritiesi

Belongs to the UTX family.Curated

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG1124 Eukaryota
KOG1246 Eukaryota
COG0457 LUCA
GeneTreeiENSGT00410000025758
HOGENOMiHOG000220834
InParanoidiO70546
KOiK11447
OMAiEDSQSPM
OrthoDBiEOG091G0OL6
TreeFamiTF317405

Family and domain databases

Gene3Di1.25.40.10, 2 hits
InterProiView protein in InterPro
IPR003347 JmjC_dom
IPR029516 KDM6C
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PANTHERiPTHR14017:SF9 PTHR14017:SF9, 2 hits
PfamiView protein in Pfam
PF02373 JmjC, 1 hit
PF13181 TPR_8, 1 hit
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
SM00028 TPR, 6 hits
SUPFAMiSSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit
PS50005 TPR, 7 hits
PS50293 TPR_REGION, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O70546-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKSCGVSLAT AAAAAAAAAF GDEEKKMAAG KASGESEEAS PSLTAEEREA
60 70 80 90 100
LGGLDSRLFG FVRFHEDGAR MKALLGKAVR CYESLILKAE GKVESDFFCQ
110 120 130 140 150
LGHFNLLLED YPKALSAYQR YYSLQSDYWK NAAFLYGLGL VYFHYNAFQW
160 170 180 190 200
AIKAFQEVLY VDPSFCRAKE IHLRLGLMFK VNTDYESSLK HFQLALVDCN
210 220 230 240 250
PCTLSNAEIQ FHIAHLYETQ RKYHSAKEAY EQLLQTENLS AQVKATILQQ
260 270 280 290 300
LGWMHHTVDL LGDKATKESY AIQYLQKSLE ADPNSGQSWY FLGRCYSSIG
310 320 330 340 350
KVQDAFISYR QSIDKSEASA DTWCSIGVLY QQQNQPMDAL QAYICAVQLD
360 370 380 390 400
HGHAAAWMDL GTLYESCNQP QDAIKCYLNA TRSKNCSNTS GLAARIKYLQ
410 420 430 440 450
AQLCNLPQGS LQNKTKLLPS IEEAWSLPIP AELTSRQGAM NTAQQNTSDN
460 470 480 490 500
WSGGNAPPPV EQQTHSWCLT PQKLQHLEQL RANRNNLNPA QKLMLEQLES
510 520 530 540 550
QFVLMQQHQM RQTGVAQVRP TGILNGPTVD SSLPTNSVSG QQPQLPLTRM
560 570 580 590 600
PSVSQPGVHT ACPRQTLANG PFSAGHVPCS TSRTLGSTDT VLIGNNHVTG
610 620 630 640 650
SGSNGNVPYL QRNAPTLPHN RTNLTSSTEE PWKNQLSNST QGLHKGPSSH
660 670 680 690 700
LAGPNGERPL SSTGPSQHLQ AAGSGIQNQN GHPTLPSNSV TQGAALNHLS
710 720 730 740 750
SHTATSGGQQ GITLTKESKP SGNTLTVPET SRQTGETPNS TASVEGLPNH
760 770 780 790 800
VHQVMADAVC SPSHGDSKSP GLLSSDNPQL SALLMGKANN NVGPGTCDKV
810 820 830 840 850
NNIHPTVHTK TDNSVASSPS SAISTATPSP KSTEQTTTNS VTSLNSPHSG
860 870 880 890 900
LHTINGEGME ESQSPIKTDL LLVSHRPSPQ IIPSMSVSIY PSSAEVLKAC
910 920 930 940 950
RNLGKNGLSN SSILLDKCPP PRPPSSPYPP LPKDKLNPPT PSIYLENKRD
960 970 980 990 1000
AFFPPLHQFC TNPNNPVTVI RGLAGALKLD LGLFSTKTLV EANNEHMVEV
1010 1020 1030 1040 1050
RTQLLQPADE NWDPTGTKKI WHCESNRSHT TIAKYAQYQA SSFQESLREE
1060 1070 1080 1090 1100
NEKRSHHKDH SDSESTSSDN SGKRRKGPFK TIKFGTNIDL SDDKKWKLQL
1110 1120 1130 1140 1150
HELTKLPAFV RVVSAGNLLS HVGHTILGMN TVQLYMKVPG SRTPGHQENN
1160 1170 1180 1190 1200
NFCSVNINIG PGDCEWFVVP EGYWGVLNDF CEKNNLNFLM GSWWPNLEDL
1210 1220 1230 1240 1250
YEANVPVYRF IQRPGDLVWI NAGTVHWVQA IGWCNNIAWN VGPLTACQYK
1260 1270 1280 1290 1300
LAVERYEWNK LQNVKSIVPM VHLSWNMARN IKVSDPKLFE MIKYCLLRTL
1310 1320 1330 1340 1350
KQCQTLREAL IAAGKEIIWH GRTKEEPAHY CSICEVEVFD LLFVTNESNS
1360 1370 1380 1390 1400
RKTYIVHCQD CARKTSGNLE NFVVLEQYKM EDLMQVYDQF TLAPPLPSAS

S
Length:1,401
Mass (Da):154,355
Last modified:January 9, 2007 - v2
Checksum:i293DA417F49EECFF
GO
Isoform 2 (identifier: O70546-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1393-1401: APPLPSASS → VSEINMLLHYHPPHLDIVPWTLNMRPFLLFRK

Show »
Length:1,424
Mass (Da):157,458
Checksum:iFD83D03980684B3C
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YCW2A0A286YCW2_MOUSE
Lysine-specific demethylase 6A
Kdm6a
236Annotation score:
A0A286YD05A0A286YD05_MOUSE
Lysine-specific demethylase 6A
Kdm6a
997Annotation score:
A0A286YD51A0A286YD51_MOUSE
Lysine-specific demethylase 6A
Kdm6a
369Annotation score:
A0A286YDX1A0A286YDX1_MOUSE
Lysine-specific demethylase 6A
Kdm6a
224Annotation score:

Sequence cautioni

The sequence AAH75703 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti321D → G in AAH75703 (PubMed:15489334).Curated1
Sequence conflicti1198E → G in AAH75703 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0221961393 – 1401APPLPSASS → VSEINMLLHYHPPHLDIVPW TLNMRPFLLFRK in isoform 2. 1 Publication9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL732451, AL773547 Genomic DNA Translation: CAM27157.1
AL773547, AL732451 Genomic DNA Translation: CAM18408.1
BC053433 mRNA Translation: AAH53433.1
BC075703 mRNA Translation: AAH75703.1 Different initiation.
AJ002730 mRNA Translation: CAA05692.1
CCDSiCCDS30037.1 [O70546-2]
CCDS81102.1 [O70546-1]
RefSeqiNP_001297373.1, NM_001310444.1 [O70546-1]
NP_033509.1, NM_009483.2 [O70546-2]
UniGeneiMm.257498
Mm.417709

Genome annotation databases

EnsembliENSMUST00000044484; ENSMUSP00000045862; ENSMUSG00000037369 [O70546-1]
ENSMUST00000052368; ENSMUSP00000061539; ENSMUSG00000037369 [O70546-2]
GeneIDi22289
KEGGimmu:22289
UCSCiuc009ssk.1 mouse [O70546-1]
uc009ssm.1 mouse [O70546-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL732451, AL773547 Genomic DNA Translation: CAM27157.1
AL773547, AL732451 Genomic DNA Translation: CAM18408.1
BC053433 mRNA Translation: AAH53433.1
BC075703 mRNA Translation: AAH75703.1 Different initiation.
AJ002730 mRNA Translation: CAA05692.1
CCDSiCCDS30037.1 [O70546-2]
CCDS81102.1 [O70546-1]
RefSeqiNP_001297373.1, NM_001310444.1 [O70546-1]
NP_033509.1, NM_009483.2 [O70546-2]
UniGeneiMm.257498
Mm.417709

3D structure databases

ProteinModelPortaliO70546
SMRiO70546
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204471, 4 interactors
IntActiO70546, 6 interactors
MINTiO70546
STRINGi10090.ENSMUSP00000061539

PTM databases

iPTMnetiO70546
PhosphoSitePlusiO70546

Proteomic databases

EPDiO70546
MaxQBiO70546
PaxDbiO70546
PeptideAtlasiO70546
PRIDEiO70546

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000044484; ENSMUSP00000045862; ENSMUSG00000037369 [O70546-1]
ENSMUST00000052368; ENSMUSP00000061539; ENSMUSG00000037369 [O70546-2]
GeneIDi22289
KEGGimmu:22289
UCSCiuc009ssk.1 mouse [O70546-1]
uc009ssm.1 mouse [O70546-2]

Organism-specific databases

CTDi7403
MGIiMGI:1095419 Kdm6a

Phylogenomic databases

eggNOGiKOG1124 Eukaryota
KOG1246 Eukaryota
COG0457 LUCA
GeneTreeiENSGT00410000025758
HOGENOMiHOG000220834
InParanoidiO70546
KOiK11447
OMAiEDSQSPM
OrthoDBiEOG091G0OL6
TreeFamiTF317405

Enzyme and pathway databases

ReactomeiR-MMU-3214842 HDMs demethylate histones

Miscellaneous databases

ChiTaRSiKdm6a mouse
PROiPR:O70546
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037369 Expressed in 283 organ(s), highest expression level in primary oocyte
ExpressionAtlasiO70546 baseline and differential
GenevisibleiO70546 MM

Family and domain databases

Gene3Di1.25.40.10, 2 hits
InterProiView protein in InterPro
IPR003347 JmjC_dom
IPR029516 KDM6C
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PANTHERiPTHR14017:SF9 PTHR14017:SF9, 2 hits
PfamiView protein in Pfam
PF02373 JmjC, 1 hit
PF13181 TPR_8, 1 hit
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
SM00028 TPR, 6 hits
SUPFAMiSSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit
PS50005 TPR, 7 hits
PS50293 TPR_REGION, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKDM6A_MOUSE
AccessioniPrimary (citable) accession number: O70546
Secondary accession number(s): A2AID2, Q6DI80, Q7TSG4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: January 9, 2007
Last modified: November 7, 2018
This is version 151 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again