Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Butyrophilin-like protein 2

Gene

Btnl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Negative regulator of T-cell proliferation.2 Publications

GO - Molecular functioni

  • signaling receptor binding Source: MGI

GO - Biological processi

  • negative regulation of T cell receptor signaling pathway Source: MGI
  • positive regulation of interleukin-2 secretion Source: MGI
  • positive regulation of T cell proliferation Source: MGI
  • regulation of immune response Source: GO_Central
  • T cell receptor signaling pathway Source: GO_Central

Enzyme and pathway databases

ReactomeiR-MMU-8851680 Butyrophilin (BTN) family interactions

Names & Taxonomyi

Protein namesi
Recommended name:
Butyrophilin-like protein 2
Gene namesi
Name:Btnl2
Synonyms:Gm315, Ng9
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1859549 Btnl2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 6CytoplasmicSequence analysis6
Transmembranei7 – 23Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini24 – 454ExtracellularSequence analysisAdd BLAST431

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000145381 – 454Butyrophilin-like protein 2Add BLAST454

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi50 ↔ 124PROSITE-ProRule annotation
Disulfide bondi164 ↔ 218PROSITE-ProRule annotation
Glycosylationi210N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi267 ↔ 341PROSITE-ProRule annotation
Glycosylationi296N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi381 ↔ 435PROSITE-ProRule annotation
Glycosylationi427N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi432N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiO70355
PaxDbiO70355
PRIDEiO70355

PTM databases

PhosphoSitePlusiO70355

Expressioni

Tissue specificityi

Highly expressed in intestine and at reduced levels in lung and stomach. Also expressed in thymus, spleen, lymph nodes, T-cells, B-cells, and macrophages.2 Publications

Gene expression databases

BgeeiENSMUSG00000024340 Expressed in 22 organ(s), highest expression level in colon
CleanExiMM_BTNL2
ExpressionAtlasiO70355 baseline and differential
GenevisibleiO70355 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000025198

Structurei

3D structure databases

ProteinModelPortaliO70355
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini27 – 140Ig-like V-type 1Add BLAST114
Domaini148 – 234Ig-like V-type 2Add BLAST87
Domaini244 – 355Ig-like V-type 3Add BLAST112
Domaini365 – 452Ig-like V-type 4Add BLAST88

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJJG Eukaryota
ENOG410YIB9 LUCA
GeneTreeiENSGT00760000118933
HOVERGENiHBG054868
InParanoidiO70355
OMAiVQWRDME
PhylomeDBiO70355
TreeFamiTF331083

Family and domain databases

Gene3Di2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR013162 CD80_C2-set
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF08205 C2-set_2, 1 hit
PF07686 V-set, 2 hits
SMARTiView protein in SMART
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SM00406 IGv, 2 hits
SUPFAMiSSF48726 SSF48726, 4 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 4 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O70355-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVDCPRYSLS GVAASFLFVL LTIKHPDDFR VVGPNLPILA KVGEDALLTC
60 70 80 90 100
QLLPKRTTAH MEVRWYRSDP DMPVIMYRDG AEVTGLPMEG YGGRAEWMED
110 120 130 140 150
STEEGSVALK IRQVQPSDDG QYWCRFQEGD YWRETSVLLQ VAALGSSPNI
160 170 180 190 200
HVEGLGEGEV QLVCTSRGWF PEPEVHWEGI WGEKLMSFSE NHVPGEDGLF
210 220 230 240 250
YVEDTLMVRN DSVETISCFI YSHGLRETQE ATIALSERLQ TELASVSVIG
260 270 280 290 300
HSQPSPVQVG ENIELTCHLS PQTDAQNLEV RWLRSRYYPA VHVYANGTHV
310 320 330 340 350
AGEQMVEYKG RTSLVTDAIH EGKLTLQIHN ARTSDEGQYR CLFGKDGVYQ
360 370 380 390 400
EARVDVQVMA VGSTPRITRE VLKDGGMQLR CTSDGWFPRP HVQWRDRDGK
410 420 430 440 450
TMPSFSEAFQ QGSQELFQVE TLLLVTNGSM VNVTCSISLP LGQEKTARFP

LSGW
Length:454
Mass (Da):50,894
Last modified:January 9, 2007 - v2
Checksum:iCE09E537F72CF123
GO
Isoform 2 (identifier: O70355-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-454: GW → DSKIALLWMTLPVVVLPLAMAIDLIKVKRWRRTNEQTHSSNQENNKNDENHRRRLPSDERLR

Note: No experimental confirmation available.
Show »
Length:514
Mass (Da):58,038
Checksum:i338128421138120A
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QP12J3QP12_MOUSE
Butyrophilin-like protein 2
Btnl2
514Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_022147453 – 454GW → DSKIALLWMTLPVVVLPLAM AIDLIKVKRWRRTNEQTHSS NQENNKNDENHRRRLPSDER LR in isoform 2. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK136521 mRNA Translation: BAE23022.1
AF050157 Genomic DNA Translation: AAC05288.1 Different termination.
CR974457 Genomic DNA Translation: CAO77746.1
CCDSiCCDS37585.1 [O70355-2]
RefSeqiNP_524574.1, NM_079835.2 [O70355-2]
UniGeneiMm.441007

Genome annotation databases

EnsembliENSMUST00000025198; ENSMUSP00000025198; ENSMUSG00000024340 [O70355-2]
GeneIDi547431
KEGGimmu:547431
UCSCiuc008ccl.1 mouse [O70355-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK136521 mRNA Translation: BAE23022.1
AF050157 Genomic DNA Translation: AAC05288.1 Different termination.
CR974457 Genomic DNA Translation: CAO77746.1
CCDSiCCDS37585.1 [O70355-2]
RefSeqiNP_524574.1, NM_079835.2 [O70355-2]
UniGeneiMm.441007

3D structure databases

ProteinModelPortaliO70355
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000025198

PTM databases

PhosphoSitePlusiO70355

Proteomic databases

MaxQBiO70355
PaxDbiO70355
PRIDEiO70355

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000025198; ENSMUSP00000025198; ENSMUSG00000024340 [O70355-2]
GeneIDi547431
KEGGimmu:547431
UCSCiuc008ccl.1 mouse [O70355-2]

Organism-specific databases

CTDi56244
MGIiMGI:1859549 Btnl2

Phylogenomic databases

eggNOGiENOG410IJJG Eukaryota
ENOG410YIB9 LUCA
GeneTreeiENSGT00760000118933
HOVERGENiHBG054868
InParanoidiO70355
OMAiVQWRDME
PhylomeDBiO70355
TreeFamiTF331083

Enzyme and pathway databases

ReactomeiR-MMU-8851680 Butyrophilin (BTN) family interactions

Miscellaneous databases

PROiPR:O70355
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024340 Expressed in 22 organ(s), highest expression level in colon
CleanExiMM_BTNL2
ExpressionAtlasiO70355 baseline and differential
GenevisibleiO70355 MM

Family and domain databases

Gene3Di2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR013162 CD80_C2-set
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF08205 C2-set_2, 1 hit
PF07686 V-set, 2 hits
SMARTiView protein in SMART
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SM00406 IGv, 2 hits
SUPFAMiSSF48726 SSF48726, 4 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 4 hits
ProtoNetiSearch...

Entry informationi

Entry nameiBTNL2_MOUSE
AccessioniPrimary (citable) accession number: O70355
Secondary accession number(s): A6X8K1, Q3UW94
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: January 9, 2007
Last modified: November 7, 2018
This is version 121 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again