Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

G protein-coupled receptor kinase 6

Gene

Grk6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis (By similarity). Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor, LRP6 during Wnt signaling (in vitro) (By similarity).By similarity3 Publications

Catalytic activityi

ATP + [G-protein-coupled receptor] = ADP + [G-protein-coupled receptor] phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei215ATPPROSITE-ProRule annotation1
Active sitei311Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi192 – 200ATPPROSITE-ProRule annotation9
Nucleotide bindingi264 – 270ATPPROSITE-ProRule annotation7
Nucleotide bindingi315 – 318ATPPROSITE-ProRule annotation4

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processWnt signaling pathway
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.16 3474
ReactomeiR-MMU-418555 G alpha (s) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
G protein-coupled receptor kinase 6 (EC:2.7.11.16)
Alternative name(s):
G protein-coupled receptor kinase GRK6
Gene namesi
Name:Grk6
Synonyms:Gprk6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1347078 Grk6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Deficient mice show significant altered central dopamine receptors regulation, deficient lymphocyte chemotaxis and increased acute inflammation and neutrophil chemotaxis.3 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000859751 – 576G protein-coupled receptor kinase 6Add BLAST576

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei484PhosphoserineCombined sources1
Modified residuei485PhosphothreonineCombined sources1
Lipidationi561S-palmitoyl cysteineBy similarity1
Lipidationi562S-palmitoyl cysteineBy similarity1
Lipidationi565S-palmitoyl cysteineBy similarity1
Modified residuei566PhosphoserineCombined sources1
Modified residuei568PhosphoserineCombined sources1
Isoform GRK6B (identifier: O70293-2)
Modified residuei578PhosphoserineCombined sources1

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiO70293
PaxDbiO70293
PeptideAtlasiO70293
PRIDEiO70293

PTM databases

iPTMnetiO70293
PhosphoSitePlusiO70293
SwissPalmiO70293

Expressioni

Tissue specificityi

Expressed in the brain in striatal neurons.1 Publication

Gene expression databases

BgeeiENSMUSG00000074886 Expressed in 279 organ(s), highest expression level in spleen
CleanExiMM_GRK6
ExpressionAtlasiO70293 baseline and differential
GenevisibleiO70293 MM

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SLC9A3R1Q286195EBI-7073604,EBI-7073613From Oryctolagus cuniculus.

Protein-protein interaction databases

CORUMiO70293
IntActiO70293, 3 interactors
MINTiO70293
STRINGi10090.ENSMUSP00000001115

Structurei

3D structure databases

ProteinModelPortaliO70293
SMRiO70293
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini53 – 171RGSPROSITE-ProRule annotationAdd BLAST119
Domaini186 – 448Protein kinasePROSITE-ProRule annotationAdd BLAST263
Domaini449 – 514AGC-kinase C-terminalAdd BLAST66

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 185N-terminalAdd BLAST185

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0986 Eukaryota
ENOG410YRQZ LUCA
GeneTreeiENSGT00860000133699
HOGENOMiHOG000006742
HOVERGENiHBG004532
InParanoidiO70293
KOiK08291
OrthoDBiEOG091G062G
PhylomeDBiO70293
TreeFamiTF313940

Family and domain databases

InterProiView protein in InterPro
IPR000961 AGC-kinase_C
IPR000239 GPCR_kinase
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR016137 RGS
IPR036305 RGS_sf
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
PF00615 RGS, 1 hit
PRINTSiPR00717 GPCRKINASE
SMARTiView protein in SMART
SM00315 RGS, 1 hit
SM00133 S_TK_X, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF48097 SSF48097, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51285 AGC_KINASE_CTER, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
PS50132 RGS, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform GRK6A (identifier: O70293-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELENIVANT VLLKAREGGG GNRKGKSKKW RQMLQFPHIS QCEELRLSLE
60 70 80 90 100
RDYHSLCERQ PIGRLLFREF CATRPELTRC TAFLDGVSEY EVTPDEKRKA
110 120 130 140 150
CGRRLMQNFL SHTGPDLIPE VPRQLVSNCA QRLEQGPCKD LFQELTRLTH
160 170 180 190 200
EYLSTAPFAD YLDSIYFNRF LQWKWLERQP VTKNTFRQYR VLGKGGFGEV
210 220 230 240 250
CACQVRATGK MYACKKLEKK RIKKRKGEAM ALNEKQILEK VNSRFVVSLA
260 270 280 290 300
YAYETKDALC LVLTLMNGGD LKFHIYHMGQ AGFPEARAVF YAAEICCGLE
310 320 330 340 350
DLHRERIVYR DLKPENILLD DHGHIRISDL GLAVHVPEGQ TIKGRVGTVG
360 370 380 390 400
YMAPEVVRNE RYTFSPDWWA LGCLLYEMIA GQSPFQQRKK KIKREEVERL
410 420 430 440 450
VKEVAEEYTD RFSSQARSLC SQLLSKDPAE RLGCRGGGAR EVKEHPLFKK
460 470 480 490 500
LNFKRLGAGM LEPPFKPDPQ AIYCKDVLDI EQFSTVKGVD LEPTDQDFYQ
510 520 530 540 550
KFATGSVSIP WQNEMVETEC FQELNVFGLD GSVPPDLDWK GQPTAPPKKG
560 570
LLQRLFSRQD CCGNCSDSEE ELPTRL
Length:576
Mass (Da):65,979
Last modified:August 1, 1998 - v1
Checksum:i91EEC2028CAF4B91
GO
Isoform GRK6B (identifier: O70293-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     560-576: DCCGNCSDSEEELPTRL → RIAVGTAATVRKSSPPASSPQAEAPTGGWR

Show »
Length:589
Mass (Da):67,115
Checksum:iC08443E7CB2B714D
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q9EP84Q9EP84_MOUSE
G protein-coupled receptor kinase
Grk6 Gprk6, GRK6, GRK6-C, mCG_3177
560Annotation score:
A0A286YDA5A0A286YDA5_MOUSE
G protein-coupled receptor kinase
Grk6
584Annotation score:
A0A286YE10A0A286YE10_MOUSE
G protein-coupled receptor kinase
Grk6
542Annotation score:
A0A286YDZ5A0A286YDZ5_MOUSE
G protein-coupled receptor kinase
Grk6
557Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti98R → Q in AAC09265 (PubMed:10506199).Curated1
Sequence conflicti571E → K in AAC09265 (PubMed:10506199).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_004939560 – 576DCCGN…LPTRL → RIAVGTAATVRKSSPPASSP QAEAPTGGWR in isoform GRK6B. 3 PublicationsAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040747 mRNA Translation: AAC09268.1
AF040748 mRNA Translation: AAC09269.1
AF040749 mRNA Translation: AAC09270.1
AF040754 Genomic DNA Translation: AAC09265.1
Y17967 Genomic DNA Translation: CAA76975.1
Y17967 Genomic DNA Translation: CAA76976.1
Y15798 mRNA Translation: CAA75789.1
Y15799 mRNA Translation: CAA75790.1
BC075719 mRNA Translation: AAH75719.1
CCDSiCCDS49272.1 [O70293-2]
RefSeqiNP_001033107.1, NM_001038018.4 [O70293-2]
NP_001106182.1, NM_001112711.2 [O70293-1]
NP_001272992.1, NM_001286063.1
NP_001272993.1, NM_001286064.1
NP_001272994.1, NM_001286065.1
NP_036068.2, NM_011938.4
UniGeneiMm.10193

Genome annotation databases

EnsembliENSMUST00000001115; ENSMUSP00000001115; ENSMUSG00000074886 [O70293-2]
ENSMUST00000224118; ENSMUSP00000152968; ENSMUSG00000074886 [O70293-1]
GeneIDi26385
KEGGimmu:26385
UCSCiuc007qqw.2 mouse [O70293-2]
uc011yzt.2 mouse [O70293-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040747 mRNA Translation: AAC09268.1
AF040748 mRNA Translation: AAC09269.1
AF040749 mRNA Translation: AAC09270.1
AF040754 Genomic DNA Translation: AAC09265.1
Y17967 Genomic DNA Translation: CAA76975.1
Y17967 Genomic DNA Translation: CAA76976.1
Y15798 mRNA Translation: CAA75789.1
Y15799 mRNA Translation: CAA75790.1
BC075719 mRNA Translation: AAH75719.1
CCDSiCCDS49272.1 [O70293-2]
RefSeqiNP_001033107.1, NM_001038018.4 [O70293-2]
NP_001106182.1, NM_001112711.2 [O70293-1]
NP_001272992.1, NM_001286063.1
NP_001272993.1, NM_001286064.1
NP_001272994.1, NM_001286065.1
NP_036068.2, NM_011938.4
UniGeneiMm.10193

3D structure databases

ProteinModelPortaliO70293
SMRiO70293
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

CORUMiO70293
IntActiO70293, 3 interactors
MINTiO70293
STRINGi10090.ENSMUSP00000001115

PTM databases

iPTMnetiO70293
PhosphoSitePlusiO70293
SwissPalmiO70293

Proteomic databases

MaxQBiO70293
PaxDbiO70293
PeptideAtlasiO70293
PRIDEiO70293

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000001115; ENSMUSP00000001115; ENSMUSG00000074886 [O70293-2]
ENSMUST00000224118; ENSMUSP00000152968; ENSMUSG00000074886 [O70293-1]
GeneIDi26385
KEGGimmu:26385
UCSCiuc007qqw.2 mouse [O70293-2]
uc011yzt.2 mouse [O70293-1]

Organism-specific databases

CTDi2870
MGIiMGI:1347078 Grk6

Phylogenomic databases

eggNOGiKOG0986 Eukaryota
ENOG410YRQZ LUCA
GeneTreeiENSGT00860000133699
HOGENOMiHOG000006742
HOVERGENiHBG004532
InParanoidiO70293
KOiK08291
OrthoDBiEOG091G062G
PhylomeDBiO70293
TreeFamiTF313940

Enzyme and pathway databases

BRENDAi2.7.11.16 3474
ReactomeiR-MMU-418555 G alpha (s) signalling events

Miscellaneous databases

PROiPR:O70293
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000074886 Expressed in 279 organ(s), highest expression level in spleen
CleanExiMM_GRK6
ExpressionAtlasiO70293 baseline and differential
GenevisibleiO70293 MM

Family and domain databases

InterProiView protein in InterPro
IPR000961 AGC-kinase_C
IPR000239 GPCR_kinase
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR016137 RGS
IPR036305 RGS_sf
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
PF00615 RGS, 1 hit
PRINTSiPR00717 GPCRKINASE
SMARTiView protein in SMART
SM00315 RGS, 1 hit
SM00133 S_TK_X, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF48097 SSF48097, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51285 AGC_KINASE_CTER, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
PS50132 RGS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGRK6_MOUSE
AccessioniPrimary (citable) accession number: O70293
Secondary accession number(s): O70294, O70295, Q6DI67
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: August 1, 1998
Last modified: November 7, 2018
This is version 170 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again