Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Epsilon-sarcoglycan

Gene

Sgce

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.

Names & Taxonomyi

Protein namesi
Recommended name:
Epsilon-sarcoglycan
Short name:
Epsilon-SG
Gene namesi
Name:Sgce
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1329042 Sgce

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 317ExtracellularSequence analysisAdd BLAST317
Transmembranei318 – 338HelicalSequence analysisAdd BLAST21
Topological domaini339 – 437CytoplasmicSequence analysisAdd BLAST99

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi60H → P or R: Misfolded, leading to the interaction with TOR1A, ubiquitination and a decrease of the half-life. Impairs intracellular transport. No effect on glycosylation. 1 Publication1
Mutagenesisi196L → R: Misfolded, leading to the interaction with TOR1A, ubiquitination and a decrease of the half-life. Impairs intracellular transport. No effect on glycosylation. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000316781 – 437Epsilon-sarcoglycanAdd BLAST437

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi200N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

N-glycosylated.1 Publication
Ubiquitinated, leading to its degradation by the proteasome.1 Publication

Keywords - PTMi

Glycoprotein, Ubl conjugation

Proteomic databases

MaxQBiO70258
PRIDEiO70258

PTM databases

iPTMnetiO70258
PhosphoSitePlusiO70258

Expressioni

Tissue specificityi

Identified in all tissues tested. Expression highest in lung and placenta, moderate in brain, heart and skeletal muscle, low in kidney and liver. Also detected in embryo.

Gene expression databases

BgeeiENSMUSG00000004631 Expressed in 280 organ(s), highest expression level in sciatic nerve
CleanExiMM_SGCE
ExpressionAtlasiO70258 baseline and differential
GenevisibleiO70258 MM

Interactioni

Protein-protein interaction databases

BioGridi203196, 1 interactor
CORUMiO70258

Structurei

3D structure databases

ProteinModelPortaliO70258
SMRiO70258
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi235 – 341Cys-richAdd BLAST107

Sequence similaritiesi

Belongs to the sarcoglycan alpha/epsilon family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000005672
HOGENOMiHOG000074154
HOVERGENiHBG006891
InParanoidiO70258
OrthoDBiEOG091G07H7
PhylomeDBiO70258
TreeFamiTF314655

Family and domain databases

InterProiView protein in InterPro
IPR006644 Cadg
IPR008908 Sarcoglycan_alpha/epsilon
IPR030775 SGCE
PANTHERiPTHR10132 PTHR10132, 1 hit
PTHR10132:SF17 PTHR10132:SF17, 1 hit
PfamiView protein in Pfam
PF05510 Sarcoglycan_2, 1 hit
SMARTiView protein in SMART
SM00736 CADG, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O70258-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLLFWWWELG DPCAWTGKGR GTLKMSPATT GTFLLTVYTL FSKVHSDRNV
60 70 80 90 100
YPSAGVLFVH VLEREYFKGE FPPYPKPGEV SNDPITFNTN LMGYPDRPGW
110 120 130 140 150
LRYIQRTPYS DGVLYGSPTA ENVGKPTIIE ITAYNRRTFE TARHNLIINI
160 170 180 190 200
MSAEEFPLPY QAEFFIKNMN VEEMLASEVL GDFLGAVKNV WQPERLNAIN
210 220 230 240 250
ITSALDRGGR VPLPINDMKE GVYVMVGADV AFSSCLREVE NPQNQLRCSQ
260 270 280 290 300
EMEPVITCDK KFRTHFHIDW CKISLVDKTK QVSTYQEVVR GEGILPDGGE
310 320 330 340 350
YKPPSDSLKS RDYYTDFLVT LAVPSAVALV LFLILAYIMC CRREGVEKRD
360 370 380 390 400
MQTPDIQLVH HSSIQKSTKE LRDMSKNREI AWPLSTLPVF HPVTGEVIPP
410 420 430
THTDNYDSTN MPLMQAQQNL PHQTQIPQPQ TTGKWYP
Length:437
Mass (Da):49,736
Last modified:July 7, 2009 - v2
Checksum:iA294007261593637
GO
Isoform 2 (identifier: O70258-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-36: T → TAFLLSCADGINGTVNWKTKQASSFSISRKLAAGKKD

Show »
Length:473
Mass (Da):53,532
Checksum:iDCAE4D4FFA879CA6
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PX46E9PX46_MOUSE
Epsilon-sarcoglycan
Sgce
434Annotation score:
F8WGM3F8WGM3_MOUSE
Epsilon-sarcoglycan
Sgce
451Annotation score:
F6R6P2F6R6P2_MOUSE
Epsilon-sarcoglycan
Sgce
443Annotation score:
D3Z572D3Z572_MOUSE
Epsilon-sarcoglycan
Sgce
428Annotation score:
F6WKE4F6WKE4_MOUSE
Epsilon-sarcoglycan
Sgce
396Annotation score:
F6ULV5F6ULV5_MOUSE
Epsilon-sarcoglycan
Sgce
59Annotation score:

Sequence cautioni

The sequence AAC14020 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH12665 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC36184 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti401T → M in AAH12665 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00601936T → TAFLLSCADGINGTVNWKTK QASSFSISRKLAAGKKD in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC012665 mRNA Translation: AAH12665.1 Different initiation.
AF031919 mRNA Translation: AAC14020.1 Different initiation.
AK076102 mRNA Translation: BAC36184.1 Different initiation.
AF103877 mRNA Translation: AAF21895.1
CCDSiCCDS51716.1 [O70258-1]
CCDS51718.1 [O70258-2]
RefSeqiNP_001123660.1, NM_001130188.1 [O70258-2]
NP_001123661.1, NM_001130189.1
NP_001123662.1, NM_001130190.1
NP_035490.3, NM_011360.3 [O70258-1]
UniGeneiMm.8739

Genome annotation databases

EnsembliENSMUST00000115577; ENSMUSP00000111240; ENSMUSG00000004631 [O70258-2]
ENSMUST00000115579; ENSMUSP00000111242; ENSMUSG00000004631 [O70258-1]
GeneIDi20392
KEGGimmu:20392
UCSCiuc009avp.2 mouse [O70258-1]
uc009avq.2 mouse [O70258-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC012665 mRNA Translation: AAH12665.1 Different initiation.
AF031919 mRNA Translation: AAC14020.1 Different initiation.
AK076102 mRNA Translation: BAC36184.1 Different initiation.
AF103877 mRNA Translation: AAF21895.1
CCDSiCCDS51716.1 [O70258-1]
CCDS51718.1 [O70258-2]
RefSeqiNP_001123660.1, NM_001130188.1 [O70258-2]
NP_001123661.1, NM_001130189.1
NP_001123662.1, NM_001130190.1
NP_035490.3, NM_011360.3 [O70258-1]
UniGeneiMm.8739

3D structure databases

ProteinModelPortaliO70258
SMRiO70258
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi203196, 1 interactor
CORUMiO70258

PTM databases

iPTMnetiO70258
PhosphoSitePlusiO70258

Proteomic databases

MaxQBiO70258
PRIDEiO70258

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000115577; ENSMUSP00000111240; ENSMUSG00000004631 [O70258-2]
ENSMUST00000115579; ENSMUSP00000111242; ENSMUSG00000004631 [O70258-1]
GeneIDi20392
KEGGimmu:20392
UCSCiuc009avp.2 mouse [O70258-1]
uc009avq.2 mouse [O70258-2]

Organism-specific databases

CTDi8910
MGIiMGI:1329042 Sgce

Phylogenomic databases

GeneTreeiENSGT00390000005672
HOGENOMiHOG000074154
HOVERGENiHBG006891
InParanoidiO70258
OrthoDBiEOG091G07H7
PhylomeDBiO70258
TreeFamiTF314655

Miscellaneous databases

PROiPR:O70258
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000004631 Expressed in 280 organ(s), highest expression level in sciatic nerve
CleanExiMM_SGCE
ExpressionAtlasiO70258 baseline and differential
GenevisibleiO70258 MM

Family and domain databases

InterProiView protein in InterPro
IPR006644 Cadg
IPR008908 Sarcoglycan_alpha/epsilon
IPR030775 SGCE
PANTHERiPTHR10132 PTHR10132, 1 hit
PTHR10132:SF17 PTHR10132:SF17, 1 hit
PfamiView protein in Pfam
PF05510 Sarcoglycan_2, 1 hit
SMARTiView protein in SMART
SM00736 CADG, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSGCE_MOUSE
AccessioniPrimary (citable) accession number: O70258
Secondary accession number(s): Q921G2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: July 7, 2009
Last modified: November 7, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again