Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O61967 (LAP1_CAEEL)

Entry version 159 (26 Feb 2020)
Sequence version 3 (27 Sep 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein lap1

Gene

let-413

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Critical role in assembling adherens junctions; adapter protein involved in polarizing protein trafficking in epithelial cells. Necessary to maintain, not establish, the entire terminal web (organelle-depleted, intermediate filament-rich layer of cytoplasm that underlies the apical microvilli of polarized epithelial cells) or brush border assembly at the apical surface gut cells. Required for correct localization of ifb-2 intermediate filaments in the terminal web. Required for dlg-1 lateral localization (PubMed:18411252). With dlg-1, cooperatively regulates ajm-1 localization to apical junctions (PubMed:11715019).4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-CEL-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-CEL-6798695 Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein lap1
Alternative name(s):
Lethal protein 413
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:let-413Imported
ORF Names:F26D11.11Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Ecdysozoa › Nematoda › Chromadorea › Rhabditida › Rhabditina › Rhabditomorpha › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome V

Organism-specific databases

WormBase

More...WormBasei		F26D11.11a ; CE29778 ; WBGene00002632 ; let-413
F26D11.11b ; CE37008 ; WBGene00002632 ; let-413

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Worms display a severely affected epithelial integrity, leading to abnormal morphogenesis of the pharynx, intestine and embryo.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi305P → L: Abolishes membrane localization. 2 Publications1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001883051 – 699Protein lap1Add BLAST699

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O61967

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O61967

PeptideAtlas

More...PeptideAtlasi		O61967

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O61967

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the terminal web of the intestine (PubMed:15063180, PubMed:27506200). Expressed in seam cells (PubMed:27506200).2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in all embryonic epithelial cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		WBGene00002632 Expressed in pharyngeal muscle cell (C elegans) and 4 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		44213, 12 interactors

Database of interacting proteins

More...DIPi		DIP-25349N

Protein interaction database and analysis system

More...IntActi		O61967, 7 interactors

STRING: functional protein association networks

More...STRINGi		6239.F26D11.11b

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati37 – 59LRR 1Add BLAST23
Repeati60 – 81LRR 2Add BLAST22
Repeati83 – 104LRR 3Add BLAST22
Repeati106 – 127LRR 4Add BLAST22
Repeati129 – 150LRR 5Add BLAST22
Repeati152 – 174LRR 6Add BLAST23
Repeati175 – 196LRR 7Add BLAST22
Repeati198 – 219LRR 8Add BLAST22
Repeati221 – 242LRR 9Add BLAST22
Repeati244 – 265LRR 10Add BLAST22
Repeati267 – 288LRR 11Add BLAST22
Repeati290 – 311LRR 12Add BLAST22
Repeati313 – 334LRR 13Add BLAST22
Repeati336 – 357LRR 14Add BLAST22
Repeati359 – 380LRR 15Add BLAST22
Repeati382 – 403LRR 16Add BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini584 – 665PDZPROSITE-ProRule annotationAdd BLAST82

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LAP (LRR and PDZ) protein family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0619 Eukaryota
KOG3528 Eukaryota
COG4886 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000164066

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000288_18_23_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O61967

Identification of Orthologs from Complete Genome Data

More...OMAi		DIFRFRK

Database of Orthologous Groups

More...OrthoDBi		442171at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O61967

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.80.10.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF13855 LRR_8, 3 hits
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00369 LRR_TYP, 12 hits
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51450 LRR, 14 hits
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform b (identifier: O61967-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPAFFCLPMA CQRQVDSIDR SQSNLQAIPS DIFRFRKLED LNLTMNNIKE 
        60         70         80         90        100
LDHRLFSLRH LRILDVSDNE LAVLPAEIGN LTQLIELNLN RNSIAKLPDT 
       110        120        130        140        150
MQNCKLLTTL NLSSNPFTRL PETICECSSI TILSLNETSL TLLPSNIGSL 
       160        170        180        190        200
TNLRVLEARD NLLRTIPLSI VELRKLEELD LGQNELEALP AEIGKLTSLR 
       210        220        230        240        250
EFYVDINSLT SLPDSISGCR MLDQLDVSEN QIIRLPENLG RMPNLTDLNI 
       260        270        280        290        300
SINEIIELPS SFGELKRLQM LKADRNSLHN LTSEIGKCQS LTELYLGQNF 
       310        320        330        340        350
LTDLPDTIGD LRQLTTLNVD CNNLSDIPDT IGNCKSLTVL SLRQNILTEL 
       360        370        380        390        400
PMTIGKCENL TVLDVASNKL PHLPFTVKVL YKLQALWLSE NQTQSILKLS 
       410        420        430        440        450
ETRDDRKGIK VVTCYLLPQV DAIDGEGRSG SAQHNTDRGA FLGGPKVHFH 
       460        470        480        490        500
DQADTTFEEN KEAEIHLGNF ERHNTPHPKT PKHKKGSIDG HMLPHEIDQP 
       510        520        530        540        550
RQLSLVSNHR TSTSSFGESS NSINRDLADI RAQNGVREAT LSPEREERMA 
       560        570        580        590        600
TSLSSLSNLA AGTQNMHTIR IQKDDTGKLG LSFAGGTSND PAPNSNGDSG 
       610        620        630        640        650
LFVTKVTPGS AAYRCGLREG DKLIRANDVN MINASQDNAM EAIKKRETVE 
       660        670        680        690 
LVVLRRSPSP VSRTSEPSLN GSSHQLNHFD AGSPDSTMFV TSSTPVYAS
Length:699
Mass (Da):77,350
Last modified:September 27, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2CE6478B5039F2DE
GO
Isoform a (identifier: O61967-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     531-531: R → RFIDAPAS
     666-699: EPSLNGSSHQLNHFDAGSPDSTMFVTSSTPVYAS → VSRPCEY

Show »
Length:679
Mass (Da):75,336
Checksum:i608B8EDF5AC0F947
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A5K1I804A0A5K1I804_CAEEL
Protein lap1
let-413 CELE_F26D11.11, F26D11.11
682Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5K1IAV7A0A5K1IAV7_CAEEL
Protein lap1
let-413 CELE_F26D11.11, F26D11.11
689Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5K1IC26A0A5K1IC26_CAEEL
Protein lap1
let-413 CELE_F26D11.11, F26D11.11
706Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5K1I8A6A0A5K1I8A6_CAEEL
Protein lap1
let-413 CELE_F26D11.11, F26D11.11
669Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_015673531R → RFIDAPAS in isoform a. 1 Publication1
Alternative sequenceiVSP_015674666 – 699EPSLN…PVYAS → VSRPCEY in isoform a. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ276590 mRNA Translation: CAB91651.1
FO081227 Genomic DNA Translation: CCD70053.1
FO081227 Genomic DNA Translation: CCD70054.1

Protein sequence database of the Protein Information Resource

More...PIRi		T33295

NCBI Reference Sequences

More...RefSeqi		NP_001023850.1, NM_001028679.3
NP_001023851.1, NM_001028680.3 [O61967-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...EnsemblMetazoai		F26D11.11a.1; F26D11.11a.1; WBGene00002632 [O61967-2]
F26D11.11b.1; F26D11.11b.1; WBGene00002632 [O61967-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		179171

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		cel:CELE_F26D11.11

UCSC genome browser

More...UCSCi		F26D11.11a c. elegans [O61967-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ276590 mRNA Translation: CAB91651.1
FO081227 Genomic DNA Translation: CCD70053.1
FO081227 Genomic DNA Translation: CCD70054.1
PIRiT33295
RefSeqiNP_001023850.1, NM_001028679.3
NP_001023851.1, NM_001028680.3 [O61967-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi44213, 12 interactors
DIPiDIP-25349N
IntActiO61967, 7 interactors
STRINGi6239.F26D11.11b

PTM databases

iPTMnetiO61967

Proteomic databases

EPDiO61967
PaxDbiO61967
PeptideAtlasiO61967

Genome annotation databases

EnsemblMetazoaiF26D11.11a.1; F26D11.11a.1; WBGene00002632 [O61967-2]
F26D11.11b.1; F26D11.11b.1; WBGene00002632 [O61967-1]
GeneIDi179171
KEGGicel:CELE_F26D11.11
UCSCiF26D11.11a c. elegans [O61967-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		179171
WormBaseiF26D11.11a ; CE29778 ; WBGene00002632 ; let-413
F26D11.11b ; CE37008 ; WBGene00002632 ; let-413

Phylogenomic databases

eggNOGiKOG0619 Eukaryota
KOG3528 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00940000164066
HOGENOMiCLU_000288_18_23_1
InParanoidiO61967
OMAiDIFRFRK
OrthoDBi442171at2759
PhylomeDBiO61967

Enzyme and pathway databases

ReactomeiR-CEL-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-CEL-6798695 Neutrophil degranulation

Miscellaneous databases

Protein Ontology

More...PROi		PR:O61967

Gene expression databases

BgeeiWBGene00002632 Expressed in pharyngeal muscle cell (C elegans) and 4 other tissues

Family and domain databases

Gene3Di3.80.10.10, 3 hits
InterProiView protein in InterPro
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF13855 LRR_8, 3 hits
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00369 LRR_TYP, 12 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS51450 LRR, 14 hits
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLAP1_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O61967
Secondary accession number(s): Q6A580, Q9NFN7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: September 27, 2005
Last modified: February 26, 2020
This is version 159 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again