Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-1,4-galactosyltransferase 2

Gene

B4GALT2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. Can produce lactose.

Catalytic activityi

UDP-alpha-D-galactose + D-glucose = UDP + lactose.
UDP-alpha-D-galactose + N-acetyl-beta-D-glucosaminylglycopeptide = UDP + beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminylglycopeptide.
UDP-alpha-D-galactose + N-acetyl-D-glucosamine = UDP + N-acetyllactosamine.

Cofactori

Mn2+By similarity

Kineticsi

  1. KM=71 µM for GlcNAc-B-S-pNP1 Publication

    Pathwayi: protein glycosylation

    This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
    View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Metal bindingi218ManganeseBy similarity1
    Binding sitei278UDP-alpha-D-galactoseBy similarity1
    Metal bindingi311Manganese; via tele nitrogenBy similarity1
    Binding sitei323N-acetyl-D-glucosamineBy similarity1

    GO - Molecular functioni

    GO - Biological processi

    Keywordsi

    Molecular functionGlycosyltransferase, Transferase
    LigandManganese, Metal-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS04130-MONOMER
    BRENDAi2.4.1.38 2681
    2.4.1.90 2681
    ReactomeiR-HSA-2022854 Keratan sulfate biosynthesis
    R-HSA-975577 N-Glycan antennae elongation
    SABIO-RKiO60909
    UniPathwayi
    UPA00378

    Protein family/group databases

    CAZyiGT7 Glycosyltransferase Family 7

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Beta-1,4-galactosyltransferase 2 (EC:2.4.1.-)
    Short name:
    Beta-1,4-GalTase 2
    Short name:
    Beta4Gal-T2
    Short name:
    b4Gal-T2
    Alternative name(s):
    UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2
    UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2
    Including the following 4 domains:
    Lactose synthase A protein (EC:2.4.1.22)
    N-acetyllactosamine synthase (EC:2.4.1.90)
    Alternative name(s):
    Nal synthase
    Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase (EC:2.4.1.38)
    Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase (EC:2.4.1.-)
    Gene namesi
    Name:B4GALT2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 1

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000117411.16
    HGNCiHGNC:925 B4GALT2
    MIMi604013 gene
    neXtProtiNX_O60909

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Topological domaini1 – 15CytoplasmicSequence analysisAdd BLAST15
    Transmembranei16 – 36Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
    Topological domaini37 – 372LumenalSequence analysisAdd BLAST336

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    DisGeNETi8704
    OpenTargetsiENSG00000117411
    PharmGKBiPA25224

    Chemistry databases

    DrugBankiDB00141 N-Acetyl-D-glucosamine

    Polymorphism and mutation databases

    BioMutaiB4GALT2

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00000805331 – 372Beta-1,4-galactosyltransferase 2Add BLAST372

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Glycosylationi66N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi71N-linked (GlcNAc...) asparagineSequence analysis1
    Disulfide bondi97 ↔ 139By similarity
    Disulfide bondi211 ↔ 230By similarity
    Glycosylationi357N-linked (GlcNAc...) asparagineSequence analysis1

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiO60909
    PaxDbiO60909
    PeptideAtlasiO60909
    PRIDEiO60909
    ProteomicsDBi49666
    49667 [O60909-2]
    49668 [O60909-3]

    PTM databases

    iPTMnetiO60909
    PhosphoSitePlusiO60909

    Expressioni

    Tissue specificityi

    Weakly expressed in various tissues. Highest expression in prostate, testis, ovary, intestine, muscle, and in fetal brain.

    Gene expression databases

    BgeeiENSG00000117411 Expressed in 200 organ(s), highest expression level in superior frontal gyrus
    CleanExiHS_B4GALT2
    GenevisibleiO60909 HS

    Organism-specific databases

    HPAiHPA007620
    HPA047739

    Interactioni

    Protein-protein interaction databases

    BioGridi114247, 1 interactor
    IntActiO60909, 2 interactors
    STRINGi9606.ENSP00000310696

    Structurei

    3D structure databases

    ProteinModelPortaliO60909
    SMRiO60909
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Regioni150 – 154UDP-alpha-D-galactose bindingBy similarity5
    Regioni189 – 191UDP-alpha-D-galactose bindingBy similarity3
    Regioni217 – 218UDP-alpha-D-galactose bindingBy similarity2
    Regioni280 – 283N-acetyl-D-glucosamine bindingBy similarity4
    Regioni311 – 313UDP-alpha-D-galactose bindingBy similarity3

    Sequence similaritiesi

    Belongs to the glycosyltransferase 7 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiKOG3916 Eukaryota
    ENOG410ZYYA LUCA
    GeneTreeiENSGT00760000119140
    HOGENOMiHOG000231027
    HOVERGENiHBG058334
    InParanoidiO60909
    KOiK07967
    OMAiEDATYDC
    OrthoDBiEOG091G0P66
    PhylomeDBiO60909
    TreeFamiTF312834

    Family and domain databases

    Gene3Di3.90.550.10, 1 hit
    InterProiView protein in InterPro
    IPR003859 Galactosyl_T
    IPR027791 Galactosyl_T_C
    IPR027995 Galactosyl_T_N
    IPR029044 Nucleotide-diphossugar_trans
    PANTHERiPTHR19300 PTHR19300, 1 hit
    PfamiView protein in Pfam
    PF02709 Glyco_transf_7C, 1 hit
    PF13733 Glyco_transf_7N, 1 hit
    PRINTSiPR02050 B14GALTRFASE
    SUPFAMiSSF53448 SSF53448, 1 hit

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: O60909-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MSRLLGGTLE RVCKAVLLLC LLHFLVAVIL YFDVYAQHLA FFSRFSARGP
    60 70 80 90 100
    AHALHPAASS SSSSSNCSRP NATASSSGLP EVPSALPGPT APTLPPCPDS
    110 120 130 140 150
    PPGLVGRLLI EFTSPMPLER VQRENPGVLM GGRYTPPDCT PAQTVAVIIP
    160 170 180 190 200
    FRHREHHLRY WLHYLHPILR RQRLRYGVYV INQHGEDTFN RAKLLNVGFL
    210 220 230 240 250
    EALKEDAAYD CFIFSDVDLV PMDDRNLYRC GDQPRHFAIA MDKFGFRLPY
    260 270 280 290 300
    AGYFGGVSGL SKAQFLRING FPNEYWGWGG EDDDIFNRIS LTGMKISRPD
    310 320 330 340 350
    IRIGRYRMIK HDRDKHNEPN PQRFTKIQNT KLTMKRDGIG SVRYQVLEVS
    360 370
    RQPLFTNITV DIGRPPSWPP RG
    Length:372
    Mass (Da):41,972
    Last modified:August 1, 1998 - v1
    Checksum:iA6F7800251AA1E4F
    GO
    Isoform 2 (identifier: O60909-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-118: Missing.
         119-119: E → MPSTQLLAAAAAAATAPGPTPPPLAPGSLRSPVPCPVPRLPRCHPVLTRHLVL

    Note: No experimental confirmation available.
    Show »
    Length:306
    Mass (Da):34,883
    Checksum:iA483868104528A2B
    GO
    Isoform 3 (identifier: O60909-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAVEVQEQWPCLPAAGCPGPLGGPVAACGM

    Note: No experimental confirmation available.
    Show »
    Length:401
    Mass (Da):44,764
    Checksum:i70B4877C779850C1
    GO

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti100S → TS (PubMed:9597550).Curated1
    Sequence conflicti136P → S in AAC39733 (PubMed:9597550).Curated1
    Sequence conflicti177G → C in AAC39733 (PubMed:9597550).Curated1
    Sequence conflicti315 – 316KH → ND in AAC39733 (PubMed:9597550).Curated2

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_020487122Q → H1 PublicationCorresponds to variant dbSNP:rs1859728Ensembl.1
    Natural variantiVAR_054021338G → R. Corresponds to variant dbSNP:rs35904809Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0141031 – 118Missing in isoform 2. CuratedAdd BLAST118
    Alternative sequenceiVSP_0430101M → MAVEVQEQWPCLPAAGCPGP LGGPVAACGM in isoform 3. 1 Publication1
    Alternative sequenceiVSP_014104119E → MPSTQLLAAAAAAATAPGPT PPPLAPGSLRSPVPCPVPRL PRCHPVLTRHLVL in isoform 2. Curated1

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    Y12510 mRNA Translation: CAA73112.1
    AF038660 mRNA Translation: AAC39733.1
    AB024434 mRNA Translation: BAA75819.1
    AK095873 mRNA Translation: BAG53152.1
    AK293418 mRNA Translation: BAG56925.1
    AL139220 Genomic DNA No translation available.
    AL357079 Genomic DNA No translation available.
    CH471059 Genomic DNA Translation: EAX07062.1
    CH471059 Genomic DNA Translation: EAX07063.1
    CH471059 Genomic DNA Translation: EAX07064.1
    CH471059 Genomic DNA Translation: EAX07065.1
    BC096821 mRNA Translation: AAH96821.1
    AL137647 mRNA Translation: CAB70857.1
    CCDSiCCDS506.1 [O60909-1]
    CCDS55596.1 [O60909-3]
    PIRiT46511
    RefSeqiNP_001005417.1, NM_001005417.2 [O60909-1]
    NP_003771.1, NM_003780.4 [O60909-1]
    NP_085076.2, NM_030587.2 [O60909-3]
    XP_016858205.1, XM_017002716.1 [O60909-1]
    XP_016858206.1, XM_017002717.1 [O60909-1]
    UniGeneiHs.632403
    Hs.736507

    Genome annotation databases

    EnsembliENST00000309519; ENSP00000310696; ENSG00000117411 [O60909-3]
    ENST00000356836; ENSP00000349293; ENSG00000117411 [O60909-1]
    ENST00000372324; ENSP00000361399; ENSG00000117411 [O60909-1]
    ENST00000434555; ENSP00000407468; ENSG00000117411 [O60909-2]
    GeneIDi8704
    KEGGihsa:8704
    UCSCiuc001clg.4 human [O60909-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Similar proteinsi

    Cross-referencesi

    Web resourcesi

    Functional Glycomics Gateway - GTase

    Beta-1,4-galactosyltransferase 2

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    Y12510 mRNA Translation: CAA73112.1
    AF038660 mRNA Translation: AAC39733.1
    AB024434 mRNA Translation: BAA75819.1
    AK095873 mRNA Translation: BAG53152.1
    AK293418 mRNA Translation: BAG56925.1
    AL139220 Genomic DNA No translation available.
    AL357079 Genomic DNA No translation available.
    CH471059 Genomic DNA Translation: EAX07062.1
    CH471059 Genomic DNA Translation: EAX07063.1
    CH471059 Genomic DNA Translation: EAX07064.1
    CH471059 Genomic DNA Translation: EAX07065.1
    BC096821 mRNA Translation: AAH96821.1
    AL137647 mRNA Translation: CAB70857.1
    CCDSiCCDS506.1 [O60909-1]
    CCDS55596.1 [O60909-3]
    PIRiT46511
    RefSeqiNP_001005417.1, NM_001005417.2 [O60909-1]
    NP_003771.1, NM_003780.4 [O60909-1]
    NP_085076.2, NM_030587.2 [O60909-3]
    XP_016858205.1, XM_017002716.1 [O60909-1]
    XP_016858206.1, XM_017002717.1 [O60909-1]
    UniGeneiHs.632403
    Hs.736507

    3D structure databases

    ProteinModelPortaliO60909
    SMRiO60909
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi114247, 1 interactor
    IntActiO60909, 2 interactors
    STRINGi9606.ENSP00000310696

    Chemistry databases

    DrugBankiDB00141 N-Acetyl-D-glucosamine

    Protein family/group databases

    CAZyiGT7 Glycosyltransferase Family 7

    PTM databases

    iPTMnetiO60909
    PhosphoSitePlusiO60909

    Polymorphism and mutation databases

    BioMutaiB4GALT2

    Proteomic databases

    MaxQBiO60909
    PaxDbiO60909
    PeptideAtlasiO60909
    PRIDEiO60909
    ProteomicsDBi49666
    49667 [O60909-2]
    49668 [O60909-3]

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000309519; ENSP00000310696; ENSG00000117411 [O60909-3]
    ENST00000356836; ENSP00000349293; ENSG00000117411 [O60909-1]
    ENST00000372324; ENSP00000361399; ENSG00000117411 [O60909-1]
    ENST00000434555; ENSP00000407468; ENSG00000117411 [O60909-2]
    GeneIDi8704
    KEGGihsa:8704
    UCSCiuc001clg.4 human [O60909-1]

    Organism-specific databases

    CTDi8704
    DisGeNETi8704
    EuPathDBiHostDB:ENSG00000117411.16
    GeneCardsiB4GALT2
    HGNCiHGNC:925 B4GALT2
    HPAiHPA007620
    HPA047739
    MIMi604013 gene
    neXtProtiNX_O60909
    OpenTargetsiENSG00000117411
    PharmGKBiPA25224
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG3916 Eukaryota
    ENOG410ZYYA LUCA
    GeneTreeiENSGT00760000119140
    HOGENOMiHOG000231027
    HOVERGENiHBG058334
    InParanoidiO60909
    KOiK07967
    OMAiEDATYDC
    OrthoDBiEOG091G0P66
    PhylomeDBiO60909
    TreeFamiTF312834

    Enzyme and pathway databases

    UniPathwayi
    UPA00378

    BioCyciMetaCyc:HS04130-MONOMER
    BRENDAi2.4.1.38 2681
    2.4.1.90 2681
    ReactomeiR-HSA-2022854 Keratan sulfate biosynthesis
    R-HSA-975577 N-Glycan antennae elongation
    SABIO-RKiO60909

    Miscellaneous databases

    ChiTaRSiB4GALT2 human
    GeneWikiiB4GALT2
    GenomeRNAii8704
    PROiPR:O60909
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000117411 Expressed in 200 organ(s), highest expression level in superior frontal gyrus
    CleanExiHS_B4GALT2
    GenevisibleiO60909 HS

    Family and domain databases

    Gene3Di3.90.550.10, 1 hit
    InterProiView protein in InterPro
    IPR003859 Galactosyl_T
    IPR027791 Galactosyl_T_C
    IPR027995 Galactosyl_T_N
    IPR029044 Nucleotide-diphossugar_trans
    PANTHERiPTHR19300 PTHR19300, 1 hit
    PfamiView protein in Pfam
    PF02709 Glyco_transf_7C, 1 hit
    PF13733 Glyco_transf_7N, 1 hit
    PRINTSiPR02050 B14GALTRFASE
    SUPFAMiSSF53448 SSF53448, 1 hit
    ProtoNetiSearch...

    Entry informationi

    Entry nameiB4GT2_HUMAN
    AccessioniPrimary (citable) accession number: O60909
    Secondary accession number(s): B3KTP0
    , B4DE14, D3DPY6, D3DPY7, O60511, Q4V9L9, Q5T4X5, Q5T4Y5, Q9BUP6, Q9NSY7
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
    Last sequence update: August 1, 1998
    Last modified: September 12, 2018
    This is version 165 of the entry and version 1 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again