Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 176 (12 Aug 2020)
Sequence version 1 (01 Aug 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Beta-1,4-galactosyltransferase 2

Gene

B4GALT2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids (PubMed:9405390). Can produce lactose (PubMed:9405390).1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+By similarity

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=71 µM for GlcNAc-B-S-pNP1 Publication
  2. KM=0.011 mM for UDP-galactose1 Publication
  3. KM=0.16 mM for benzyl-beta-D-GlcNAc1 Publication
  4. KM=2.65 mM for D-GlcNAc1 Publication
  1. Vmax=207.6 pmol/min/mg enzyme towards UDP-galactose1 Publication
  2. Vmax=352 pmol/min/mg enzyme towards for benzyl-beta-D-GlcNAc1 Publication
  3. Vmax=237.6 pmol/min/mg enzyme towards D-GlcNAc1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi218ManganeseBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei278UDP-alpha-D-galactoseBy similarity1
Metal bindingi311Manganese; via tele nitrogenBy similarity1
Binding sitei323N-acetyl-D-glucosamineBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase
LigandManganese, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS04130-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.4.1.38, 2681
2.4.1.90, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
O60909

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2022854, Keratan sulfate biosynthesis
R-HSA-975577, N-Glycan antennae elongation

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
O60909

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00378

Protein family/group databases

Carbohydrate-Active enZymes

More...
CAZyi
GT7, Glycosyltransferase Family 7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Beta-1,4-galactosyltransferase 2Curated (EC:2.4.1.-1 Publication)
Short name:
Beta-1,4-GalTase 21 Publication
Short name:
Beta4Gal-T2
Short name:
b4Gal-T21 Publication
Alternative name(s):
Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase
Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase1 Publication (EC:2.4.1.381 Publication)
Lactose synthase A protein (EC:2.4.1.22)
N-acetyllactosamine synthase1 Publication (EC:2.4.1.901 Publication)
Nal synthase
UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2
UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:B4GALT2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000117411.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:925, B4GALT2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604013, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O60909

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 15CytoplasmicSequence analysisAdd BLAST15
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei16 – 36Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini37 – 372LumenalSequence analysisAdd BLAST336

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8704

Open Targets

More...
OpenTargetsi
ENSG00000117411

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25224

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O60909, Tbio

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00141, N-Acetylglucosamine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
B4GALT2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000805331 – 372Beta-1,4-galactosyltransferase 2Add BLAST372

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi66N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi71N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi97 ↔ 139By similarity
Disulfide bondi211 ↔ 230By similarity
Glycosylationi357N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O60909

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O60909

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O60909

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O60909

PeptideAtlas

More...
PeptideAtlasi
O60909

PRoteomics IDEntifications database

More...
PRIDEi
O60909

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
49666 [O60909-1]
49667 [O60909-2]
49668 [O60909-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
O60909, 3 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O60909

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O60909

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Weakly expressed in various tissues. Highest expression in prostate, testis, ovary, intestine, muscle, and in fetal brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000117411, Expressed in superior frontal gyrus and 216 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O60909, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000117411, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
114247, 1 interactor

Protein interaction database and analysis system

More...
IntActi
O60909, 4 interactors

Molecular INTeraction database

More...
MINTi
O60909

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000310696

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O60909, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O60909

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni150 – 154UDP-alpha-D-galactose bindingBy similarity5
Regioni189 – 191UDP-alpha-D-galactose bindingBy similarity3
Regioni217 – 218UDP-alpha-D-galactose bindingBy similarity2
Regioni280 – 283N-acetyl-D-glucosamine bindingBy similarity4
Regioni311 – 313UDP-alpha-D-galactose bindingBy similarity3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycosyltransferase 7 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3916, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159367

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_044391_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O60909

KEGG Orthology (KO)

More...
KOi
K07967

Identification of Orthologs from Complete Genome Data

More...
OMAi
YVISQHG

Database of Orthologous Groups

More...
OrthoDBi
1201618at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O60909

TreeFam database of animal gene trees

More...
TreeFami
TF312834

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.550.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003859, Galactosyl_T
IPR027791, Galactosyl_T_C
IPR027995, Galactosyl_T_N
IPR029044, Nucleotide-diphossugar_trans

The PANTHER Classification System

More...
PANTHERi
PTHR19300, PTHR19300, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02709, Glyco_transf_7C, 1 hit
PF13733, Glyco_transf_7N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR02050, B14GALTRFASE

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53448, SSF53448, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O60909-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRLLGGTLE RVCKAVLLLC LLHFLVAVIL YFDVYAQHLA FFSRFSARGP
60 70 80 90 100
AHALHPAASS SSSSSNCSRP NATASSSGLP EVPSALPGPT APTLPPCPDS
110 120 130 140 150
PPGLVGRLLI EFTSPMPLER VQRENPGVLM GGRYTPPDCT PAQTVAVIIP
160 170 180 190 200
FRHREHHLRY WLHYLHPILR RQRLRYGVYV INQHGEDTFN RAKLLNVGFL
210 220 230 240 250
EALKEDAAYD CFIFSDVDLV PMDDRNLYRC GDQPRHFAIA MDKFGFRLPY
260 270 280 290 300
AGYFGGVSGL SKAQFLRING FPNEYWGWGG EDDDIFNRIS LTGMKISRPD
310 320 330 340 350
IRIGRYRMIK HDRDKHNEPN PQRFTKIQNT KLTMKRDGIG SVRYQVLEVS
360 370
RQPLFTNITV DIGRPPSWPP RG
Length:372
Mass (Da):41,972
Last modified:August 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA6F7800251AA1E4F
GO
Isoform 2 (identifier: O60909-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-118: Missing.
     119-119: E → MPSTQLLAAAAAAATAPGPTPPPLAPGSLRSPVPCPVPRLPRCHPVLTRHLVL

Show »
Length:306
Mass (Da):34,883
Checksum:iA483868104528A2B
GO
Isoform 3 (identifier: O60909-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAVEVQEQWPCLPAAGCPGPLGGPVAACGM

Show »
Length:401
Mass (Da):44,764
Checksum:i70B4877C779850C1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti100S → TS (PubMed:9597550).Curated1
Sequence conflicti136P → S in AAC39733 (PubMed:9597550).Curated1
Sequence conflicti177G → C in AAC39733 (PubMed:9597550).Curated1
Sequence conflicti315 – 316KH → ND in AAC39733 (PubMed:9597550).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_020487122Q → H1 PublicationCorresponds to variant dbSNP:rs1859728Ensembl.1
Natural variantiVAR_054021338G → R. Corresponds to variant dbSNP:rs35904809Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0141031 – 118Missing in isoform 2. CuratedAdd BLAST118
Alternative sequenceiVSP_0430101M → MAVEVQEQWPCLPAAGCPGP LGGPVAACGM in isoform 3. 1 Publication1
Alternative sequenceiVSP_014104119E → MPSTQLLAAAAAAATAPGPT PPPLAPGSLRSPVPCPVPRL PRCHPVLTRHLVL in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y12510 mRNA Translation: CAA73112.1
AF038660 mRNA Translation: AAC39733.1
AB024434 mRNA Translation: BAA75819.1
AK095873 mRNA Translation: BAG53152.1
AK293418 mRNA Translation: BAG56925.1
AL139220 Genomic DNA No translation available.
AL357079 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07062.1
CH471059 Genomic DNA Translation: EAX07063.1
CH471059 Genomic DNA Translation: EAX07064.1
CH471059 Genomic DNA Translation: EAX07065.1
BC096821 mRNA Translation: AAH96821.1
AL137647 mRNA Translation: CAB70857.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS506.1 [O60909-1]
CCDS55596.1 [O60909-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46511

NCBI Reference Sequences

More...
RefSeqi
NP_001005417.1, NM_001005417.2 [O60909-1]
NP_003771.1, NM_003780.4 [O60909-1]
NP_085076.2, NM_030587.2 [O60909-3]
XP_016858205.1, XM_017002716.1 [O60909-1]
XP_016858206.1, XM_017002717.1 [O60909-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000309519; ENSP00000310696; ENSG00000117411 [O60909-3]
ENST00000356836; ENSP00000349293; ENSG00000117411 [O60909-1]
ENST00000372324; ENSP00000361399; ENSG00000117411 [O60909-1]
ENST00000434555; ENSP00000407468; ENSG00000117411 [O60909-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8704

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8704

UCSC genome browser

More...
UCSCi
uc001clg.4, human [O60909-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - GTase

Beta-1,4-galactosyltransferase 2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y12510 mRNA Translation: CAA73112.1
AF038660 mRNA Translation: AAC39733.1
AB024434 mRNA Translation: BAA75819.1
AK095873 mRNA Translation: BAG53152.1
AK293418 mRNA Translation: BAG56925.1
AL139220 Genomic DNA No translation available.
AL357079 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07062.1
CH471059 Genomic DNA Translation: EAX07063.1
CH471059 Genomic DNA Translation: EAX07064.1
CH471059 Genomic DNA Translation: EAX07065.1
BC096821 mRNA Translation: AAH96821.1
AL137647 mRNA Translation: CAB70857.1
CCDSiCCDS506.1 [O60909-1]
CCDS55596.1 [O60909-3]
PIRiT46511
RefSeqiNP_001005417.1, NM_001005417.2 [O60909-1]
NP_003771.1, NM_003780.4 [O60909-1]
NP_085076.2, NM_030587.2 [O60909-3]
XP_016858205.1, XM_017002716.1 [O60909-1]
XP_016858206.1, XM_017002717.1 [O60909-1]

3D structure databases

SMRiO60909
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114247, 1 interactor
IntActiO60909, 4 interactors
MINTiO60909
STRINGi9606.ENSP00000310696

Chemistry databases

DrugBankiDB00141, N-Acetylglucosamine

Protein family/group databases

CAZyiGT7, Glycosyltransferase Family 7

PTM databases

GlyGeniO60909, 3 sites
iPTMnetiO60909
PhosphoSitePlusiO60909

Polymorphism and mutation databases

BioMutaiB4GALT2

Proteomic databases

jPOSTiO60909
MassIVEiO60909
MaxQBiO60909
PaxDbiO60909
PeptideAtlasiO60909
PRIDEiO60909
ProteomicsDBi49666 [O60909-1]
49667 [O60909-2]
49668 [O60909-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
32429, 177 antibodies

Genome annotation databases

EnsembliENST00000309519; ENSP00000310696; ENSG00000117411 [O60909-3]
ENST00000356836; ENSP00000349293; ENSG00000117411 [O60909-1]
ENST00000372324; ENSP00000361399; ENSG00000117411 [O60909-1]
ENST00000434555; ENSP00000407468; ENSG00000117411 [O60909-2]
GeneIDi8704
KEGGihsa:8704
UCSCiuc001clg.4, human [O60909-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8704
DisGeNETi8704
EuPathDBiHostDB:ENSG00000117411.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
B4GALT2
HGNCiHGNC:925, B4GALT2
HPAiENSG00000117411, Low tissue specificity
MIMi604013, gene
neXtProtiNX_O60909
OpenTargetsiENSG00000117411
PharmGKBiPA25224

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3916, Eukaryota
GeneTreeiENSGT00940000159367
HOGENOMiCLU_044391_0_0_1
InParanoidiO60909
KOiK07967
OMAiYVISQHG
OrthoDBi1201618at2759
PhylomeDBiO60909
TreeFamiTF312834

Enzyme and pathway databases

UniPathwayiUPA00378
BioCyciMetaCyc:HS04130-MONOMER
BRENDAi2.4.1.38, 2681
2.4.1.90, 2681
PathwayCommonsiO60909
ReactomeiR-HSA-2022854, Keratan sulfate biosynthesis
R-HSA-975577, N-Glycan antennae elongation
SABIO-RKiO60909

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
8704, 12 hits in 872 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
B4GALT2, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
B4GALT2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8704
PharosiO60909, Tbio

Protein Ontology

More...
PROi
PR:O60909
RNActiO60909, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000117411, Expressed in superior frontal gyrus and 216 other tissues
GenevisibleiO60909, HS

Family and domain databases

Gene3Di3.90.550.10, 1 hit
InterProiView protein in InterPro
IPR003859, Galactosyl_T
IPR027791, Galactosyl_T_C
IPR027995, Galactosyl_T_N
IPR029044, Nucleotide-diphossugar_trans
PANTHERiPTHR19300, PTHR19300, 1 hit
PfamiView protein in Pfam
PF02709, Glyco_transf_7C, 1 hit
PF13733, Glyco_transf_7N, 1 hit
PRINTSiPR02050, B14GALTRFASE
SUPFAMiSSF53448, SSF53448, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiB4GT2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O60909
Secondary accession number(s): B3KTP0
, B4DE14, D3DPY6, D3DPY7, O60511, Q4V9L9, Q5T4X5, Q5T4Y5, Q9BUP6, Q9NSY7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: August 1, 1998
Last modified: August 12, 2020
This is version 176 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again