Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 156 (13 Feb 2019)
Sequence version 2 (29 Mar 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein CutA

Gene

CUTA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • copper ion binding Source: GO_Central
  • enzyme binding Source: UniProtKB

GO - Biological processi

  • protein localization Source: UniProtKB
  • response to metal ion Source: InterPro

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein CutA
Alternative name(s):
Acetylcholinesterase-associated protein
Brain acetylcholinesterase putative membrane anchor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CUTA
Synonyms:ACHAP, C6orf82
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000112514.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21101 CUTA

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O60888

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51596

Open Targets

More...
OpenTargetsi
ENSG00000112514

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134928220

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CUTA

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 32Sequence analysisAdd BLAST32
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000637933 – 179Protein CutAAdd BLAST147

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated.1 Publication

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O60888

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O60888

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O60888

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O60888

PeptideAtlas

More...
PeptideAtlasi
O60888

PRoteomics IDEntifications database

More...
PRIDEi
O60888

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49653
49654 [O60888-2]
49655 [O60888-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O60888

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O60888

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O60888

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Widely expressed in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000112514 Expressed in 223 organ(s), highest expression level in adenohypophysis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O60888 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O60888 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB016787
HPA064369

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119628, 26 interactors

Protein interaction database and analysis system

More...
IntActi
O60888, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363624

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1179
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XK8X-ray2.70A/B/C/D/E/F44-179[»]
2ZFHX-ray2.05A/B/C/D/E/F1-179[»]

Database of protein disorder

More...
DisProti
DP00846

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O60888

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O60888

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O60888

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni168 – 176O-glycosylated at one site9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi34 – 37Poly-Leu4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CutA family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3338 Eukaryota
COG1324 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000017030

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051265

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O60888

KEGG Orthology (KO)

More...
KOi
K03926

Identification of Orthologs from Complete Genome Data

More...
OMAi
SPYLHWV

Database of Orthologous Groups

More...
OrthoDBi
1589955at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O60888

TreeFam database of animal gene trees

More...
TreeFami
TF313269

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.120, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004323 Ion_tolerance_CutA
IPR011322 N-reg_PII-like_a/b
IPR015867 N-reg_PII/ATP_PRibTrfase_C

The PANTHER Classification System

More...
PANTHERi
PTHR23419 PTHR23419, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03091 CutA1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54913 SSF54913, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform B (identifier: O60888-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGGRAPAVL LGGVASLLLS FVWMPALLPV ASRLLLLPRV LLTMASGSPP
60 70 80 90 100
TQPSPASDSG SGYVPGSVSA AFVTCPNEKV AKEIARAVVE KRLAACVNLI
110 120 130 140 150
PQITSIYEWK GKIEEDSEVL MMIKTQSSLV PALTDFVRSV HPYEVAEVIA
160 170
LPVEQGNFPY LQWVRQVTES VSDSITVLP
Note: No experimental confirmation available.
Length:179
Mass (Da):19,116
Last modified:March 29, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB8EBD7F8C069862A
GO
Isoform A (identifier: O60888-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MSGGRAPAVLLGGV → MIGSGLAGSGGAGGPSSTVTWCALFSNHVAATQ

Note: No experimental confirmation available.
Show »
Length:198
Mass (Da):20,925
Checksum:i6FF4D190577FBA1A
GO
Isoform C (identifier: O60888-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.

Show »
Length:156
Mass (Da):16,833
Checksum:i9438E6E87D96F3EF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IZQ5C9IZQ5_HUMAN
Protein CutA
CUTA
155Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDR4H0YDR4_HUMAN
Protein CutA
CUTA
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IZG4C9IZG4_HUMAN
Protein CutA
CUTA
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2Q5F2Z2Q5_HUMAN
Protein CutA
CUTA
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF61220 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0132261 – 23Missing in isoform C. 3 PublicationsAdd BLAST23
Alternative sequenceiVSP_0132251 – 14MSGGR…LLGGV → MIGSGLAGSGGAGGPSSTVT WCALFSNHVAATQ in isoform A. CuratedAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF230924 mRNA Translation: AAF61220.1 Different initiation.
AF106943 mRNA Translation: AAD21026.1
AL050332 Genomic DNA Translation: CAB63779.1
AL021366 Genomic DNA Translation: CAA16160.1
AL662799 Genomic DNA No translation available.
BX088650 Genomic DNA No translation available.
BC005890 mRNA Translation: AAH05890.1
BC107751 mRNA Translation: AAI07752.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34432.1 [O60888-2]
CCDS34433.1 [O60888-1]
CCDS4779.1 [O60888-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001014433.1, NM_001014433.2 [O60888-2]
NP_001014837.1, NM_001014837.1 [O60888-3]
NP_001014838.1, NM_001014838.1 [O60888-3]
NP_001014840.1, NM_001014840.1 [O60888-1]
NP_057005.1, NM_015921.2 [O60888-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.520070

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374496; ENSP00000363620; ENSG00000112514 [O60888-3]
ENST00000374500; ENSP00000363624; ENSG00000112514 [O60888-2]
ENST00000435267; ENSP00000391509; ENSG00000226492 [O60888-2]
ENST00000440279; ENSP00000403268; ENSG00000112514 [O60888-3]
ENST00000440930; ENSP00000400114; ENSG00000226492 [O60888-1]
ENST00000487148; ENSP00000432744; ENSG00000226492 [O60888-3]
ENST00000488034; ENSP00000417544; ENSG00000112514 [O60888-1]
ENST00000607266; ENSP00000475963; ENSG00000112514 [O60888-3]
ENST00000611509; ENSP00000480360; ENSG00000112514 [O60888-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51596

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51596

UCSC genome browser

More...
UCSCi
uc003oej.2 human [O60888-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF230924 mRNA Translation: AAF61220.1 Different initiation.
AF106943 mRNA Translation: AAD21026.1
AL050332 Genomic DNA Translation: CAB63779.1
AL021366 Genomic DNA Translation: CAA16160.1
AL662799 Genomic DNA No translation available.
BX088650 Genomic DNA No translation available.
BC005890 mRNA Translation: AAH05890.1
BC107751 mRNA Translation: AAI07752.1
CCDSiCCDS34432.1 [O60888-2]
CCDS34433.1 [O60888-1]
CCDS4779.1 [O60888-3]
RefSeqiNP_001014433.1, NM_001014433.2 [O60888-2]
NP_001014837.1, NM_001014837.1 [O60888-3]
NP_001014838.1, NM_001014838.1 [O60888-3]
NP_001014840.1, NM_001014840.1 [O60888-1]
NP_057005.1, NM_015921.2 [O60888-3]
UniGeneiHs.520070

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XK8X-ray2.70A/B/C/D/E/F44-179[»]
2ZFHX-ray2.05A/B/C/D/E/F1-179[»]
DisProtiDP00846
ProteinModelPortaliO60888
SMRiO60888
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119628, 26 interactors
IntActiO60888, 12 interactors
STRINGi9606.ENSP00000363624

PTM databases

iPTMnetiO60888
PhosphoSitePlusiO60888
SwissPalmiO60888

Polymorphism and mutation databases

BioMutaiCUTA

Proteomic databases

EPDiO60888
jPOSTiO60888
MaxQBiO60888
PaxDbiO60888
PeptideAtlasiO60888
PRIDEiO60888
ProteomicsDBi49653
49654 [O60888-2]
49655 [O60888-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374496; ENSP00000363620; ENSG00000112514 [O60888-3]
ENST00000374500; ENSP00000363624; ENSG00000112514 [O60888-2]
ENST00000435267; ENSP00000391509; ENSG00000226492 [O60888-2]
ENST00000440279; ENSP00000403268; ENSG00000112514 [O60888-3]
ENST00000440930; ENSP00000400114; ENSG00000226492 [O60888-1]
ENST00000487148; ENSP00000432744; ENSG00000226492 [O60888-3]
ENST00000488034; ENSP00000417544; ENSG00000112514 [O60888-1]
ENST00000607266; ENSP00000475963; ENSG00000112514 [O60888-3]
ENST00000611509; ENSP00000480360; ENSG00000112514 [O60888-3]
GeneIDi51596
KEGGihsa:51596
UCSCiuc003oej.2 human [O60888-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51596
DisGeNETi51596
EuPathDBiHostDB:ENSG00000112514.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CUTA
HGNCiHGNC:21101 CUTA
HPAiCAB016787
HPA064369
neXtProtiNX_O60888
OpenTargetsiENSG00000112514
PharmGKBiPA134928220

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3338 Eukaryota
COG1324 LUCA
GeneTreeiENSGT00390000017030
HOVERGENiHBG051265
InParanoidiO60888
KOiK03926
OMAiSPYLHWV
OrthoDBi1589955at2759
PhylomeDBiO60888
TreeFamiTF313269

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CUTA human
EvolutionaryTraceiO60888

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51596

Protein Ontology

More...
PROi
PR:O60888

Gene expression databases

BgeeiENSG00000112514 Expressed in 223 organ(s), highest expression level in adenohypophysis
ExpressionAtlasiO60888 baseline and differential
GenevisibleiO60888 HS

Family and domain databases

Gene3Di3.30.70.120, 1 hit
InterProiView protein in InterPro
IPR004323 Ion_tolerance_CutA
IPR011322 N-reg_PII-like_a/b
IPR015867 N-reg_PII/ATP_PRibTrfase_C
PANTHERiPTHR23419 PTHR23419, 1 hit
PfamiView protein in Pfam
PF03091 CutA1, 1 hit
SUPFAMiSSF54913 SSF54913, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCUTA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O60888
Secondary accession number(s): A2AB26
, A2BEL4, Q3B784, Q5JXM9, Q5SU05, Q9NYQ9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 29, 2005
Last modified: February 13, 2019
This is version 156 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again