SH2D1A

Functionⁱ

Cytoplasmic adapter regulating receptors of the signaling lymphocytic activation molecule (SLAM) family such as SLAMF1, CD244, LY9, CD84, SLAMF6 and SLAMF7. In SLAM signaling seems to cooperate with SH2D1B/EAT-2. Initially it has been proposed that association with SLAMF1 prevents SLAMF1 binding to inhibitory effectors including INPP5D/SHIP1 and PTPN11/SHP-2 (PubMed:11806999). However, by simultaneous interactions, recruits FYN which subsequently phosphorylates and activates SLAMF1 (PubMed:12458214). Positively regulates CD244/2B4- and CD84-mediated natural killer (NK) cell functions. Can also promote CD48-, SLAMF6 -, LY9-, and SLAMF7-mediated NK cell activation. In the context of NK cell-mediated cytotoxicity enhances conjugate formation with target cells (By similarity). May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.By similarity1 Publication2 Publications

GO - Molecular functionⁱ

SH3/SH2 adaptor activity
Source: UniProtKB
Non-traceable author statementⁱ
- 9774102

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

adaptive immune response Source: UniProtKB-KW
cell-cell signaling
Source: UniProtKB
Inferred from direct assayⁱ
- 9774102
cellular defense response
Source: UniProtKB
Non-traceable author statementⁱ
- 9774102
humoral immune response Source: Ensembl
innate immune response Source: UniProtKB-KW
positive regulation of natural killer cell mediated cytotoxicity Source: Ensembl
regulation of immune response Source: Reactome

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Adaptive immunity, Immunity, Innate immunity

Biological process

Adaptive immunity, Immunity, Innate immunity

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
SignaLinkⁱ	O60880

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: SH2 domain-containing protein 1A Alternative name(s): Duncan disease SH2-protein Signaling lymphocytic activation molecule-associated protein Short name: SLAM-associated protein T-cell signal transduction molecule SAP
Gene namesⁱ	Name:SH2D1A Synonyms:DSHP, SAP
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome X

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000183918.15
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:10820 SH2D1A
MIMⁱ	300490 gene
neXtProtⁱ	NX_O60880

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Lymphoproliferative syndrome, X-linked, 1 (XLP1)11 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma.

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	32	R → Q: Strongly reduced affinity for SLAMF1. 1 Publication		1
Mutagenesisⁱ	78	R → E: Disrupts interaction with FYN. 1 Publication		1

Keywords - Diseaseⁱ

Disease mutation

Organism-specific databases

DisGeNET More...DisGeNETⁱ	4068
GeneReviewsⁱ	SH2D1A
MalaCards human disease database More...MalaCardsⁱ	SH2D1A
MIMⁱ	308240 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000183918
Orphanetⁱ	2442 X-linked lymphoproliferative disease
PharmGKBⁱ	PA35728

Chemistry databases

ChEMBLⁱ	CHEMBL2321636

ChEMBLⁱ

CHEMBL2321636

Polymorphism and mutation databases

BioMutaⁱ	SH2D1A

BioMutaⁱ

SH2D1A

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000097722	1 – 128	SH2 domain-containing protein 1AAdd BLAST		128

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	89	N6-acetyllysineCombined sources		1

Keywords - PTMⁱ

Acetylation

Proteomic databases

PaxDbⁱ	O60880
PeptideAtlas More...PeptideAtlasⁱ	O60880
PRIDEⁱ	O60880
ProteomicsDBⁱ	49642 49643 [O60880-2] 49644 [O60880-3] 49645 [O60880-4] 49646 [O60880-5] 49647 [O60880-6]

PTM databases

iPTMnetⁱ	O60880
PhosphoSitePlusⁱ	O60880

Expressionⁱ

Tissue specificityⁱ

Expressed at a high level in thymus and lung, with a lower level of expression in spleen and liver. Expressed in peripheral blood leukocytes, including T-lymphocytes. Tends to be expressed at lower levels in peripheral blood leukocytes in patients with rheumatoid arthritis.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000183918 Expressed in 117 organ(s), highest expression level in thymus
CleanExⁱ	HS_SH2D1A
Genevisibleⁱ	O60880 HS

Interactionⁱ

Subunit structureⁱ

Interacts with NTRK1, NTRK2 and NTRK3 (By similarity). Interacts with CD84, CD244, LY9, SLAMF1 and FYN.By similarity7 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
ARHGEF6	Q15052	3	EBI-15552052,EBI-1642523
ARHGEF7	Q14155	5	EBI-15552052,EBI-717515
CD244	Q9BZW8	10	EBI-6983382,EBI-1580565
CD247	P20963	5	EBI-6983382,EBI-1165705
LHX4	Q969G2	7	EBI-6983382,EBI-2865388
MET	P08581	3	EBI-6983382,EBI-1039152
SLAMF1	Q13291	12	EBI-6983382,EBI-4315002
SLAMF6	Q96DU3	12	EBI-6983382,EBI-14058448
TNK2	Q07912	3	EBI-6983382,EBI-603457
TNK2	Q07912-2	3	EBI-6983382,EBI-11994780

GO - Molecular functionⁱ

SH3/SH2 adaptor activity
Source: UniProtKB
Non-traceable author statementⁱ
- 9774102

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	110246, 24 interactors
Database of interacting proteins More...DIPⁱ	DIP-40768N
IntActⁱ	O60880, 31 interactors
Molecular INTeraction database More...MINTⁱ	O60880
STRINGⁱ	9606.ENSP00000360181

Chemistry databases

BindingDBⁱ

O60880

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	5 – 7	Combined sources	3
Helixⁱ	13 – 23	Combined sources	11
Beta strandⁱ	28 – 33	Combined sources	6
Beta strandⁱ	35 – 37	Combined sources	3
Beta strandⁱ	41 – 47	Combined sources	7
Beta strandⁱ	50 – 58	Combined sources	9
Beta strandⁱ	64 – 66	Combined sources	3
Beta strandⁱ	77 – 79	Combined sources	3
Helixⁱ	80 – 87	Combined sources	8
Beta strandⁱ	89 – 96	Combined sources	8

Show more details

3D structure databases

ProteinModelPortalⁱ	O60880
SMRⁱ	O60880
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	O60880

EvolutionaryTraceⁱ

O60880

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	6 – 104	SH2PROSITE-ProRule annotationAdd BLAST		99

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	67 – 92	Interaction with FYN SH3 domainBy similarityAdd BLAST		26

Keywords - Domainⁱ

SH2 domain

Phylogenomic databases

eggNOGⁱ	ENOG410IRBY Eukaryota ENOG4111YH5 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00510000046904
HOVERGENⁱ	HBG003702
InParanoidⁱ	O60880
KEGG Orthology (KO) More...KOⁱ	K07990
OMAⁱ	CLCVLCK
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0ULG
PhylomeDBⁱ	O60880
TreeFamⁱ	TF343096

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd10400 SH2_SAP1a, 1 hit
Gene3Dⁱ	3.30.505.10, 1 hit
InterProⁱ	View protein in InterPro IPR000980 SH2 IPR036860 SH2_dom_sf IPR017289 SH2_prot_1A IPR035876 SH2D1A_SH2
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00017 SH2, 1 hit
PIRSFⁱ	PIRSF037828 SH2_p1A, 1 hit
PRINTSⁱ	PR00401 SH2DOMAIN
SMARTⁱ	View protein in SMART SM00252 SH2, 1 hit
SUPFAMⁱ	SSF55550 SSF55550, 1 hit
PROSITEⁱ	View protein in PROSITE PS50001 SH2, 1 hit

Sequences (6+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 6 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show all Align All

Isoform A (identifier: O60880-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAVAVYHGK ISRETGEKLL LATGLDGSYL LRDSESVPGV YCLCVLYHGY 
        60         70         80         90        100
IYTYRVSQTE TGSWSAETAP GVHKRYFRKI KNLISAFQKP DQGIVIPLQY 
       110        120 
PVEKKSSARS TQGTTGIRED PDVCLKAP

Length:128

Mass (Da):14,187

Last modified:August 1, 1998 - v1

Checksum:ⁱ90234E7A6614EE3D

GO

Isoform B (identifier: O60880-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
68-128: TAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP → HFRSQIKA

« Hide

        10         20         30         40         50
MDAVAVYHGK ISRETGEKLL LATGLDGSYL LRDSESVPGV YCLCVLYHGY 
        60         70 
IYTYRVSQTE TGSWSAEHFR SQIKA

Show »

Length:75

Mass (Da):8,392

Checksum:ⁱ49A81B180192072A

GO

Isoform C (identifier: O60880-3) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
47-128: YHGYIYTYRV...EDPDVCLKAP → QHLGYIKDISGK

« Hide

        10         20         30         40         50
MDAVAVYHGK ISRETGEKLL LATGLDGSYL LRDSESVPGV YCLCVLQHLG 

YIKDISGK

Show »

Length:58

Mass (Da):6,284

Checksum:ⁱ39720893ACB3518A

GO

Isoform D (identifier: O60880-4) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
114-116: Missing.

« Hide

        10         20         30         40         50
MDAVAVYHGK ISRETGEKLL LATGLDGSYL LRDSESVPGV YCLCVLYHGY 
        60         70         80         90        100
IYTYRVSQTE TGSWSAETAP GVHKRYFRKI KNLISAFQKP DQGIVIPLQY 
       110        120 
PVEKKSSARS TQGIREDPDV CLKAP

Show »

Length:125

Mass (Da):13,928

Checksum:ⁱ1E5EE8978D67E5D6

GO

Isoform E (identifier: O60880-5) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
40-128: VYCLCVLYHG...EDPDVCLKAP → ITVTFIHTEC...RHCNTSAVSS

« Hide

        10         20         30         40         50
MDAVAVYHGK ISRETGEKLL LATGLDGSYL LRDSESVPGI TVTFIHTECP 
        60         70 
RQKQVLGVLS ISEARSRHCN TSAVSS

Show »

Length:76

Mass (Da):8,188

Checksum:ⁱ5BA2292A94518C00

GO

Isoform F (identifier: O60880-6) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
47-128: YHGYIYTYRV...EDPDVCLKAP → ISEARSRHCNTSAVSS

« Hide

        10         20         30         40         50
MDAVAVYHGK ISRETGEKLL LATGLDGSYL LRDSESVPGV YCLCVLISEA 
        60 
RSRHCNTSAV SS

Show »

Length:62

Mass (Da):6,631

Checksum:ⁱ51B125509F7EB9C4

GO

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	A0A2R8Y573	A0A2R8Y573_HUMAN		SH2 domain-containing protein 1A SH2 domain-containing protein 1A	SH2D1A	77	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_048005	7	Y → C in XLP1; reduced protein stability and reduced affinity for SLAMF1, decreases interaction with FYN. 4 Publications	1
Natural variantⁱVAR_048006	8	H → D in XLP1. 1 Publication	1
Natural variantⁱVAR_048007	16	G → D in XLP1; abolishes interaction with SLAMF1. 1 Publication	1
Natural variantⁱVAR_048008	27	G → S in XLP1. 1 Publication	1
Natural variantⁱVAR_048009	28	S → R in XLP1; reduced protein stability. 3 Publications	1
Natural variantⁱVAR_048010	31	L → P in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 2 Publications	1
Natural variantⁱVAR_005612	32	R → T in XLP1. 2 PublicationsCorresponds to variant dbSNP:rs111033624EnsemblClinVar.	1
Natural variantⁱVAR_048011	33	D → Y in XLP1. 1 Publication	1
Natural variantⁱVAR_048012	42	C → W in XLP1; loss of interaction with CD84 and reduced affinity for SLAMF1. 2 Publications	1
Natural variantⁱVAR_048013	49	G → V in XLP1. 1 Publication	1
Natural variantⁱVAR_048014	53	T → I in XLP1; loss of interaction with CD84; loss of interaction with non-phosphorylated SLAMF1. 3 Publications	1
Natural variantⁱVAR_048015	54	Y → C in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 3 Publications	1
Natural variantⁱVAR_018307	55	R → L in XLP1; reduced affinity for SLAMF1 and FYN. 2 PublicationsCorresponds to variant dbSNP:rs111033630EnsemblClinVar.	1
Natural variantⁱVAR_048016	57	S → P in one XLP1 patient; unknown pathological significance. 1 Publication	1
Natural variantⁱVAR_005613	68	T → I in XLP1; loss of interaction with CD84; strongly reduced affinity for SLAMF1. 3 PublicationsCorresponds to variant dbSNP:rs111033627EnsemblClinVar.	1
Natural variantⁱVAR_048017	84	I → T in XLP1; reduced protein stability. 1 Publication	1
Natural variantⁱVAR_048018	87	F → S in XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. 3 Publications	1
Natural variantⁱVAR_048019	99	Q → P in XLP1; reduced protein stability and strongly reduced affinity for SLAMF1, disrupts interaction with FYN. 4 Publications	1
Natural variantⁱVAR_005614	101	P → L in XLP1; reduced protein stability and reduced affinity for SLAMF1, decreases interaction with FYN. 4 PublicationsCorresponds to variant dbSNP:rs111033626EnsemblClinVar.	1
Natural variantⁱVAR_048020	102	V → G in XLP1; reduced protein stability and strongly reduced affinity for SLAMF1, decreases interaction with FYN. 4 Publications	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Length
Alternative sequenceⁱVSP_004388	40 – 128	VYCLC…CLKAP → ITVTFIHTECPRQKQVLGVL SISEARSRHCNTSAVSS in isoform E. CuratedAdd BLAST	89
Alternative sequenceⁱVSP_004387	47 – 128	YHGYI…CLKAP → QHLGYIKDISGK in isoform C. CuratedAdd BLAST	82
Alternative sequenceⁱVSP_004389	47 – 128	YHGYI…CLKAP → ISEARSRHCNTSAVSS in isoform F. CuratedAdd BLAST	82
Alternative sequenceⁱVSP_004386	68 – 128	TAPGV…CLKAP → HFRSQIKA in isoform B. CuratedAdd BLAST	61
Alternative sequenceⁱVSP_004390	114 – 116	Missing in isoform D. Curated	3

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AL023657 mRNA Translation: CAA19222.1 AF073019 mRNA Translation: AAC62631.1 AF072930 mRNA Translation: AAC62630.1 AB586694 mRNA Translation: BAJ19023.1 AF100539 mRNA Translation: AAC79712.1 AF100540 mRNA Translation: AAC79713.1 AF100541 mRNA Translation: AAC79714.1 AF100542 mRNA Translation: AAC79715.1 AF100543 mRNA Translation: AAC79716.1 AK311911 mRNA Translation: BAG34852.1 CR542031 mRNA Translation: CAG46828.1 CR542043 mRNA Translation: CAG46840.1 AL022718 Genomic DNA No translation available. CH471107 Genomic DNA Translation: EAX11848.1 CH471107 Genomic DNA Translation: EAX11849.1 BC020732 mRNA Translation: AAH20732.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS14608.1 [O60880-1] CCDS48162.1 [O60880-4]
NCBI Reference Sequences More...RefSeqⁱ	NP_001108409.1, NM_001114937.2 [O60880-4] NP_002342.1, NM_002351.4 [O60880-1]
UniGeneⁱ	Hs.349094

Genome annotation databases

Ensemblⁱ	ENST00000360027; ENSP00000353126; ENSG00000183918 [O60880-4] ENST00000371139; ENSP00000360181; ENSG00000183918 [O60880-1] ENST00000477673; ENSP00000477094; ENSG00000183918 [O60880-5]
GeneIDⁱ	4068
KEGGⁱ	hsa:4068
UCSC genome browser More...UCSCⁱ	uc004euf.6 human [O60880-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O60880	SH2 domain-containing protein 1A		MACMU		128	UniRef100_O60880
SH2 domain-containing protein 1A		PANTR		128
SH2 domain-containing protein 1A		MACFA		128
SH2 domain-containing protein 1A		PONAB		128
SH2 domain-containing protein 1A		CALJA		128
+11
O60880-4	SH2 domain-containing protein 1A		MACMU		125	UniRef100_O60880-4
SH2 domain-containing protein 1A		Cebus capucinus imitator		125
SH2 domain-containing protein 1A		PONAB		125
SH2 domain-containing protein 1A		PANTR		125
SH2 domain-containing protein 1A		MANLE		125
+1
O60880-5	SH2D1A isoform 6		PONAB		76	UniRef100_O60880-5

Protein	Similar proteins		Species	Score	Length	Source
O60880	SH2 domain-containing protein 1A		MACMU		128	UniRef90_O60880
SH2 domain-containing protein 1A		BOVIN		128
SH2 domain-containing protein 1A		PIG		128
SH2 domain-containing protein 1A		SAGOE		127
SH2 domain-containing protein 1A		MOUSE		126
+105
O60880-2	SH2 domain-containing protein 1A		HUMAN		77	UniRef90_O60880-2
UPI00022351E7		LOXAF		68
UPI000B4F6607		MERUN		67
SH2 domain containing 1A		HUMAN		75
SH2 domain containing 1A (Fragment)		HUMAN		46
O60880-5	SH2D1A isoform 6		PONAB		76	UniRef90_O60880-5
SH2D1A isoform 6		PANTR		76

Protein	Similar proteins		Species	Score	Length	Source
O60880	SH2 domain-containing protein 1A		MACMU		128	UniRef50_O60880
SH2 domain-containing protein 1A		BOVIN		128
SH2 domain-containing protein 1A		PIG		128
SH2 domain-containing protein 1A		SAGOE		127
SH2 domain-containing protein 1A		RAT		126
+119
O60880-2	Isoform E of SH2 domain-containing protein 1A		HUMAN		76	UniRef50_O60880-5
SH2D1A isoform 6		PONAB		76
SH2D1A isoform 6		PANTR		76
UPI00022351E7		LOXAF		68
UPI000B4F6607		MERUN		67
+4
O60880-3	Chromosome undetermined SCAF11458, whole genome shotgun sequence		TETNG		48	UniRef50_O60880-3
O60880-5	SH2D1A isoform 6		PONAB		76	UniRef50_O60880-5
SH2D1A isoform 6		PANTR		76
Isoform F of SH2 domain-containing protein 1A		HUMAN		62
UPI00022351E7		LOXAF		68
UPI000B4F6607		MERUN		67
+4
O60880-6	Isoform E of SH2 domain-containing protein 1A		HUMAN		76	UniRef50_O60880-5
SH2D1A isoform 6		PONAB		76
SH2D1A isoform 6		PANTR		76
UPI00022351E7		LOXAF		68
UPI000B4F6607		MERUN		67
+4

Cross-referencesⁱ

Web resourcesⁱ

SH2D1Abase

SH2D1A mutation db

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AL023657 mRNA Translation: CAA19222.1 AF073019 mRNA Translation: AAC62631.1 AF072930 mRNA Translation: AAC62630.1 AB586694 mRNA Translation: BAJ19023.1 AF100539 mRNA Translation: AAC79712.1 AF100540 mRNA Translation: AAC79713.1 AF100541 mRNA Translation: AAC79714.1 AF100542 mRNA Translation: AAC79715.1 AF100543 mRNA Translation: AAC79716.1 AK311911 mRNA Translation: BAG34852.1 CR542031 mRNA Translation: CAG46828.1 CR542043 mRNA Translation: CAG46840.1 AL022718 Genomic DNA No translation available. CH471107 Genomic DNA Translation: EAX11848.1 CH471107 Genomic DNA Translation: EAX11849.1 BC020732 mRNA Translation: AAH20732.1
CCDSⁱ	CCDS14608.1 [O60880-1] CCDS48162.1 [O60880-4]
RefSeqⁱ	NP_001108409.1, NM_001114937.2 [O60880-4] NP_002342.1, NM_002351.4 [O60880-1]
UniGeneⁱ	Hs.349094

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1D1Z	X-ray	1.40	A/B/C/D	1-104	[»]
	1D4T	X-ray	1.10	A	1-104	[»]
	1D4W	X-ray	1.80	A/B	1-104	[»]
	1KA6	NMR	-	A	1-128	[»]
	1KA7	NMR	-	A	1-128	[»]
	1M27	X-ray	2.50	A	1-104	[»]
ProteinModelPortalⁱ	O60880
SMRⁱ	O60880
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	110246, 24 interactors
DIPⁱ	DIP-40768N
IntActⁱ	O60880, 31 interactors
MINTⁱ	O60880
STRINGⁱ	9606.ENSP00000360181

Chemistry databases

BindingDBⁱ	O60880
ChEMBLⁱ	CHEMBL2321636

PTM databases

iPTMnetⁱ	O60880
PhosphoSitePlusⁱ	O60880

Polymorphism and mutation databases

BioMutaⁱ	SH2D1A

BioMutaⁱ

SH2D1A

Proteomic databases

PaxDbⁱ	O60880
PeptideAtlasⁱ	O60880
PRIDEⁱ	O60880
ProteomicsDBⁱ	49642 49643 [O60880-2] 49644 [O60880-3] 49645 [O60880-4] 49646 [O60880-5] 49647 [O60880-6]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	4068
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000360027; ENSP00000353126; ENSG00000183918 [O60880-4] ENST00000371139; ENSP00000360181; ENSG00000183918 [O60880-1] ENST00000477673; ENSP00000477094; ENSG00000183918 [O60880-5]
GeneIDⁱ	4068
KEGGⁱ	hsa:4068
UCSCⁱ	uc004euf.6 human [O60880-1]

Organism-specific databases

CTDⁱ	4068
DisGeNETⁱ	4068
EuPathDBⁱ	HostDB:ENSG00000183918.15
GeneCardsⁱ	SH2D1A
GeneReviewsⁱ	SH2D1A
HGNCⁱ	HGNC:10820 SH2D1A
MalaCardsⁱ	SH2D1A
MIMⁱ	300490 gene 308240 phenotype
neXtProtⁱ	NX_O60880
OpenTargetsⁱ	ENSG00000183918
Orphanetⁱ	2442 X-linked lymphoproliferative disease
PharmGKBⁱ	PA35728
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IRBY Eukaryota ENOG4111YH5 LUCA
GeneTreeⁱ	ENSGT00510000046904
HOVERGENⁱ	HBG003702
InParanoidⁱ	O60880
KOⁱ	K07990
OMAⁱ	CLCVLCK
OrthoDBⁱ	EOG091G0ULG
PhylomeDBⁱ	O60880
TreeFamⁱ	TF343096

Enzyme and pathway databases

Reactomeⁱ	R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
SignaLinkⁱ	O60880

Miscellaneous databases

ChiTaRSⁱ	SH2D1A human
EvolutionaryTraceⁱ	O60880
GeneWikiⁱ	SH2D1A
GenomeRNAiⁱ	4068
Protein Ontology More...PROⁱ	PR:O60880
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000183918 Expressed in 117 organ(s), highest expression level in thymus
CleanExⁱ	HS_SH2D1A
Genevisibleⁱ	O60880 HS

Family and domain databases

CDDⁱ	cd10400 SH2_SAP1a, 1 hit
Gene3Dⁱ	3.30.505.10, 1 hit
InterProⁱ	View protein in InterPro IPR000980 SH2 IPR036860 SH2_dom_sf IPR017289 SH2_prot_1A IPR035876 SH2D1A_SH2
Pfamⁱ	View protein in Pfam PF00017 SH2, 1 hit
PIRSFⁱ	PIRSF037828 SH2_p1A, 1 hit
PRINTSⁱ	PR00401 SH2DOMAIN
SMARTⁱ	View protein in SMART SM00252 SH2, 1 hit
SUPFAMⁱ	SSF55550 SSF55550, 1 hit
PROSITEⁱ	View protein in PROSITE PS50001 SH2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	SH21A_HUMAN
Accessionⁱ	O60880Primary (citable) accession number: O60880 Secondary accession number(s): A8MSW0 Q9UNR0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 15, 1999
	Last sequence update:	August 1, 1998
	Last modified:	September 12, 2018
	This is version 164 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome X
Human chromosome X: entries, gene names and cross-references to MIM
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O60880 (SH21A_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

SH2 domain-containing protein 1A

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytosol

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Keywords - Diseasei

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Chemistry databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ