Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial import inner membrane translocase subunit Tim17-B

Gene

TIMM17B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

GO - Molecular functioni

GO - Biological processi

  • protein import into mitochondrial matrix Source: GO_Central
  • protein targeting to mitochondrion Source: ProtInc

Keywordsi

Biological processProtein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiR-HSA-1268020 Mitochondrial protein import

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial import inner membrane translocase subunit Tim17-B
Gene namesi
Name:TIMM17B
Synonyms:TIM17B
ORF Names:JM3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000126768.12
HGNCiHGNC:17310 TIMM17B
MIMi300249 gene
neXtProtiNX_O60830

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei17 – 37HelicalSequence analysisAdd BLAST21
Transmembranei61 – 77HelicalSequence analysisAdd BLAST17
Transmembranei113 – 133HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000126768
PharmGKBiPA38226

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002102871 – 172Mitochondrial import inner membrane translocase subunit Tim17-BAdd BLAST172

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi9 ↔ 78By similarity

Post-translational modificationi

Forms one disulfide bond.1 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

EPDiO60830
MaxQBiO60830
PeptideAtlasiO60830
PRIDEiO60830
ProteomicsDBi49622
TopDownProteomicsiO60830-1 [O60830-1]

PTM databases

iPTMnetiO60830
PhosphoSitePlusiO60830
SwissPalmiO60830

Expressioni

Tissue specificityi

Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.

Gene expression databases

BgeeiENSG00000126768 Expressed in 194 organ(s), highest expression level in muscle of leg
CleanExiHS_TIMM17B
ExpressionAtlasiO60830 baseline and differential
GenevisibleiO60830 HS

Organism-specific databases

HPAiHPA029093

Interactioni

Subunit structurei

Component of the TIM23 complex at least composed of TIMM23, TIMM17 (TIMM17A or TIMM17B) and TIMM50. The complex interacts with the TIMM44 component of the PAM complex and with DNAJC15.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
TIMM23O149253EBI-2372529,EBI-1047996

Protein-protein interaction databases

BioGridi115539, 18 interactors
CORUMiO60830
IntActiO60830, 12 interactors
MINTiO60830

Structurei

3D structure databases

ProteinModelPortaliO60830
SMRiO60830
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the Tim17/Tim22/Tim23 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000017780
HOGENOMiHOG000183190
HOVERGENiHBG054233
InParanoidiO60830
KOiK17795
OMAiPIIAGNF
OrthoDBiEOG091G0PGZ
PhylomeDBiO60830
TreeFamiTF106195

Family and domain databases

InterProiView protein in InterPro
IPR005678 Tim17
TIGRFAMsiTIGR00980 3a0801so1tim17, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O60830-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEYAREPCP WRIVDDCGGA FTMGVIGGGV FQAIKGFRNA PVGIRHRLRG
60 70 80 90 100
SANAVRIRAP QIGGSFAVWG GLFSTIDCGL VRLRGKEDPW NSITSGALTG
110 120 130 140 150
AVLAARSGPL AMVGSAMMGG ILLALIEGVG ILLTRYTAQQ FRNAPPFLED
160 170
PSQLPPKDGT PAPGYPSYQQ YH
Length:172
Mass (Da):18,273
Last modified:August 1, 1998 - v1
Checksum:i5DF3926F815E835A
GO
Isoform 2 (identifier: O60830-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-42: V → VCRLLSEAPLFIYSCSRSVSPTVNVSSERAESRPTLFMAVSLHMAWCLAHI

Note: No experimental confirmation available.
Show »
Length:222
Mass (Da):23,824
Checksum:iCD7DB6DA57E615BE
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GYS0V9GYS0_HUMAN
Mitochondrial import inner membrane...
TIMM17B
192Annotation score:
V9GYU0V9GYU0_HUMAN
Mitochondrial import inner membrane...
TIMM17B
159Annotation score:
V9GYK7V9GYK7_HUMAN
Mitochondrial import inner membrane...
TIMM17B
56Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04721542V → VCRLLSEAPLFIYSCSRSVS PTVNVSSERAESRPTLFMAV SLHMAWCLAHI in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF034790 mRNA Translation: AAC24694.1
AJ005895 mRNA Translation: CAA06752.1
AF077039 mRNA Translation: AAD27772.1
AK290207 mRNA Translation: BAF82896.1
AF196971 Genomic DNA No translation available.
AF207550 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50741.1
BC010142 mRNA Translation: AAH10142.1
BC091473 mRNA No translation available.
CCDSiCCDS14308.1 [O60830-1]
CCDS55411.1 [O60830-2]
RefSeqiNP_001161419.1, NM_001167947.2 [O60830-2]
NP_005825.1, NM_005834.4 [O60830-1]
UniGeneiHs.30570

Genome annotation databases

EnsembliENST00000376582; ENSP00000365766; ENSG00000126768 [O60830-1]
ENST00000396779; ENSP00000379999; ENSG00000126768 [O60830-2]
ENST00000465150; ENSP00000477073; ENSG00000126768 [O60830-2]
GeneIDi10245
KEGGihsa:10245
UCSCiuc004dla.3 human [O60830-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF034790 mRNA Translation: AAC24694.1
AJ005895 mRNA Translation: CAA06752.1
AF077039 mRNA Translation: AAD27772.1
AK290207 mRNA Translation: BAF82896.1
AF196971 Genomic DNA No translation available.
AF207550 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50741.1
BC010142 mRNA Translation: AAH10142.1
BC091473 mRNA No translation available.
CCDSiCCDS14308.1 [O60830-1]
CCDS55411.1 [O60830-2]
RefSeqiNP_001161419.1, NM_001167947.2 [O60830-2]
NP_005825.1, NM_005834.4 [O60830-1]
UniGeneiHs.30570

3D structure databases

ProteinModelPortaliO60830
SMRiO60830
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115539, 18 interactors
CORUMiO60830
IntActiO60830, 12 interactors
MINTiO60830

PTM databases

iPTMnetiO60830
PhosphoSitePlusiO60830
SwissPalmiO60830

Proteomic databases

EPDiO60830
MaxQBiO60830
PeptideAtlasiO60830
PRIDEiO60830
ProteomicsDBi49622
TopDownProteomicsiO60830-1 [O60830-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000376582; ENSP00000365766; ENSG00000126768 [O60830-1]
ENST00000396779; ENSP00000379999; ENSG00000126768 [O60830-2]
ENST00000465150; ENSP00000477073; ENSG00000126768 [O60830-2]
GeneIDi10245
KEGGihsa:10245
UCSCiuc004dla.3 human [O60830-1]

Organism-specific databases

CTDi10245
EuPathDBiHostDB:ENSG00000126768.12
GeneCardsiTIMM17B
HGNCiHGNC:17310 TIMM17B
HPAiHPA029093
MIMi300249 gene
neXtProtiNX_O60830
OpenTargetsiENSG00000126768
PharmGKBiPA38226
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000017780
HOGENOMiHOG000183190
HOVERGENiHBG054233
InParanoidiO60830
KOiK17795
OMAiPIIAGNF
OrthoDBiEOG091G0PGZ
PhylomeDBiO60830
TreeFamiTF106195

Enzyme and pathway databases

ReactomeiR-HSA-1268020 Mitochondrial protein import

Miscellaneous databases

ChiTaRSiTIMM17B human
GenomeRNAii10245
PROiPR:O60830
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000126768 Expressed in 194 organ(s), highest expression level in muscle of leg
CleanExiHS_TIMM17B
ExpressionAtlasiO60830 baseline and differential
GenevisibleiO60830 HS

Family and domain databases

InterProiView protein in InterPro
IPR005678 Tim17
TIGRFAMsiTIGR00980 3a0801so1tim17, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTI17B_HUMAN
AccessioniPrimary (citable) accession number: O60830
Secondary accession number(s): A8K2E2, J3KPV3, Q9UJV0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: August 1, 1998
Last modified: September 12, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again