Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

85/88 kDa calcium-independent phospholipase A2

Gene

PLA2G6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.
Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity.

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Activity regulationi

Inhibited by calcium-activated calmodulin.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei519NucleophilePROSITE-ProRule annotation1
Active sitei652Proton acceptorPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCalmodulin-binding, Hydrolase
Biological processChemotaxis, Lipid degradation, Lipid metabolism

Enzyme and pathway databases

BRENDAi3.1.1.4 2681
ReactomeiR-HSA-1482788 Acyl chain remodelling of PC
R-HSA-1482798 Acyl chain remodeling of CL
R-HSA-1482839 Acyl chain remodelling of PE
R-HSA-2029485 Role of phospholipids in phagocytosis
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic

Chemistry databases

SwissLipidsiSLP:000000618

Names & Taxonomyi

Protein namesi
Recommended name:
85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
Short name:
CaI-PLA2
Alternative name(s):
Group VI phospholipase A2
Short name:
GVI PLA2
Intracellular membrane-associated calcium-independent phospholipase A2 beta
Short name:
iPLA2-beta
Patatin-like phospholipase domain-containing protein 9
Short name:
PNPLA9
Gene namesi
Name:PLA2G6
Synonyms:PLPLA9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000184381.18
HGNCiHGNC:9039 PLA2G6
MIMi603604 gene
neXtProtiNX_O60733

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Neurodegeneration with brain iron accumulation 2B (NBIA2B)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA neurodegenerative disorder associated with iron accumulation in the brain, primarily in the basal ganglia. It is characterized by progressive extrapyramidal dysfunction leading to rigidity, dystonia, dysarthria and sensorimotor impairment.
See also OMIM:610217
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029372545K → T in NBIA2B. 1 PublicationCorresponds to variant dbSNP:rs121908681EnsemblClinVar.1
Natural variantiVAR_029373632R → W in NBIA2B. 1 PublicationCorresponds to variant dbSNP:rs121908683EnsemblClinVar.1
Neurodegeneration with brain iron accumulation 2A (NBIA2A)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA neurodegenerative disease characterized by pathologic axonal swelling and spheroid bodies in the central nervous system. Onset is within the first 2 years of life with death by age 10 years.
See also OMIM:256600
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029371310V → E in NBIA2A. 1 PublicationCorresponds to variant dbSNP:rs121908682EnsemblClinVar.1
Natural variantiVAR_070600484D → G in NBIA2A. 1 Publication1
Natural variantiVAR_070601661T → M in NBIA2A. 1 PublicationCorresponds to variant dbSNP:rs767689496Ensembl.1
Natural variantiVAR_029374691Missing in NBIA2A. 2 Publications1
Parkinson disease 14 (PARK14)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn adult-onset progressive neurodegenerative disorder characterized by parkinsonism, dystonia, severe cognitive decline, cerebral and cerebellar atrophy and absent iron in the basal ganglia on magnetic resonance imaging.
See also OMIM:612953
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_062530741R → Q in PARK14. 1 PublicationCorresponds to variant dbSNP:rs121908686EnsemblClinVar.1
Natural variantiVAR_062531747R → W in PARK14. 1 PublicationCorresponds to variant dbSNP:rs121908687EnsemblClinVar.1

Pharmaceutical usei

Potential target for therapeutic intervention of Barth syndrome.

Keywords - Diseasei

Disease mutation, Dystonia, Neurodegeneration, Parkinson disease, Parkinsonism

Organism-specific databases

DisGeNETi8398
GeneReviewsiPLA2G6
MalaCardsiPLA2G6
MIMi256600 phenotype
610217 phenotype
612953 phenotype
OpenTargetsiENSG00000184381
Orphaneti199351 Adult-onset dystonia-parkinsonism
35069 Infantile neuroaxonal dystrophy
PharmGKBiPA33367

Chemistry databases

ChEMBLiCHEMBL3213
DrugBankiDB01103 Quinacrine

Polymorphism and mutation databases

BioMutaiPLA2G6

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000670371 – 80685/88 kDa calcium-independent phospholipase A2Add BLAST806

Proteomic databases

EPDiO60733
MaxQBiO60733
PaxDbiO60733
PeptideAtlasiO60733
PRIDEiO60733
ProteomicsDBi49578
49579 [O60733-2]
49580 [O60733-3]
49581 [O60733-4]

PTM databases

iPTMnetiO60733
PhosphoSitePlusiO60733

Miscellaneous databases

PMAP-CutDBiO60733

Expressioni

Tissue specificityi

Four different transcripts were found to be expressed in a distinct tissue distribution.

Gene expression databases

BgeeiENSG00000184381 Expressed in 188 organ(s), highest expression level in right uterine tube
CleanExiHS_PLA2G6
ExpressionAtlasiO60733 baseline and differential
GenevisibleiO60733 HS

Organism-specific databases

HPAiHPA001171

Interactioni

Subunit structurei

Forms large oligomeric 270-350 kDa structures.

GO - Molecular functioni

Protein-protein interaction databases

BioGridi113986, 5 interactors
IntActiO60733, 11 interactors
STRINGi9606.ENSP00000333142

Chemistry databases

BindingDBiO60733

Structurei

3D structure databases

ProteinModelPortaliO60733
SMRiO60733
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati151 – 181ANK 1Add BLAST31
Repeati185 – 215ANK 2Add BLAST31
Repeati219 – 248ANK 3Add BLAST30
Repeati251 – 281ANK 4Add BLAST31
Repeati286 – 312ANK 5Add BLAST27
Repeati316 – 345ANK 6Add BLAST30
Repeati349 – 378ANK 7Add BLAST30
Domaini481 – 665PNPLAPROSITE-ProRule annotationAdd BLAST185

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni677 – 696Calmodulin-bindingBy similarityAdd BLAST20
Regioni748 – 759Calmodulin-bindingBy similarityAdd BLAST12

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi485 – 490GXGXXGPROSITE-ProRule annotation6
Motifi517 – 521GXSXGPROSITE-ProRule annotation5
Motifi652 – 654DGA/GPROSITE-ProRule annotation3

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0513 Eukaryota
COG0666 LUCA
COG3621 LUCA
GeneTreeiENSGT00530000063645
HOVERGENiHBG053482
InParanoidiO60733
KOiK16343
OMAiQREHIEN
OrthoDBiEOG091G042U
PhylomeDBiO60733
TreeFamiTF319230

Family and domain databases

CDDicd00204 ANK, 3 hits
Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR016035 Acyl_Trfase/lysoPLipase
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR002641 PNPLA_dom
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF01734 Patatin, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF52151 SSF52151, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits
PS51635 PNPLA, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform LH-iPLA2 (identifier: O60733-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQFFGRLVNT FSGVTNLFSN PFRVKEVAVA DYTSSDRVRE EGQLILFQNT
60 70 80 90 100
PNRTWDCVLV NPRNSQSGFR LFQLELEADA LVNFHQYSSQ LLPFYESSPQ
110 120 130 140 150
VLHTEVLQHL TDLIRNHPSW SVAHLAVELG IRECFHHSRI ISCANCAENE
160 170 180 190 200
EGCTPLHLAC RKGDGEILVE LVQYCHTQMD VTDYKGETVF HYAVQGDNSQ
210 220 230 240 250
VLQLLGRNAV AGLNQVNNQG LTPLHLACQL GKQEMVRVLL LCNARCNIMG
260 270 280 290 300
PNGYPIHSAM KFSQKGCAEM IISMDSSQIH SKDPRYGASP LHWAKNAEMA
310 320 330 340 350
RMLLKRGCNV NSTSSAGNTA LHVAVMRNRF DCAIVLLTHG ANADARGEHG
360 370 380 390 400
NTPLHLAMSK DNVEMIKALI VFGAEVDTPN DFGETPTFLA SKIGRLVTRK
410 420 430 440 450
AILTLLRTVG AEYCFPPIHG VPAEQGSAAP HHPFSLERAQ PPPISLNNLE
460 470 480 490 500
LQDLMHISRA RKPAFILGSM RDEKRTHDHL LCLDGGGVKG LIIIQLLIAI
510 520 530 540 550
EKASGVATKD LFDWVAGTST GGILALAILH SKSMAYMRGM YFRMKDEVFR
560 570 580 590 600
GSRPYESGPL EEFLKREFGE HTKMTDVRKP KVMLTGTLSD RQPAELHLFR
610 620 630 640 650
NYDAPETVRE PRFNQNVNLR PPAQPSDQLV WRAARSSGAA PTYFRPNGRF
660 670 680 690 700
LDGGLLANNP TLDAMTEIHE YNQDLIRKGQ ANKVKKLSIV VSLGTGRSPQ
710 720 730 740 750
VPVTCVDVFR PSNPWELAKT VFGAKELGKM VVDCCTDPDG RAVDRARAWC
760 770 780 790 800
EMVGIQYFRL NPQLGTDIML DEVSDTVLVN ALWETEVYIY EHREEFQKLI

QLLLSP
Length:806
Mass (Da):89,903
Last modified:May 30, 2000 - v2
Checksum:i8E55CD4EB9ACAD8B
GO
Isoform SH-iPLA2 (identifier: O60733-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-450: LVTRKAILTLLRTVGAEYCFPPIHGVPAEQGSAAPHHPFSLERAQPPPISLNNLE → Q

Show »
Length:752
Mass (Da):84,093
Checksum:iF1C46C9380332E1D
GO
Isoform Ankyrin-iPLA2-1 (identifier: O60733-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     477-479: HDH → CRT
     480-806: Missing.

Show »
Length:479
Mass (Da):53,216
Checksum:i2C849808049DD065
GO
Isoform Ankyrin-iPLA2-2 (identifier: O60733-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-142: Missing.
     450-499: ELQDLMHISR...GLIIIQLLIA → GSHPSQAGWW...READMQNLSP
     500-806: Missing.

Show »
Length:427
Mass (Da):46,484
Checksum:i52DAEBA2EDDC4C31
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C3P5H7C3P5_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
168Annotation score:
E7EX67E7EX67_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
226Annotation score:
H0Y7G5H0Y7G5_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
197Annotation score:
B0QYE9B0QYE9_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
166Annotation score:
H0Y6T3H0Y6T3_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
229Annotation score:
M0R1Q9M0R1Q9_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
120Annotation score:
H0Y4M7H0Y4M7_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
124Annotation score:
H0Y6W2H0Y6W2_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
157Annotation score:
F8WEN3F8WEN3_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
151Annotation score:
F2Z3G2F2Z3G2_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
99Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti11F → S in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti64N → D in AAD41722 (PubMed:10092647).Curated1
Sequence conflicti64N → D in AAD41723 (PubMed:10092647).Curated1
Sequence conflicti579K → I in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti686K → I in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti801Q → H in AAC97486 (PubMed:9417066).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01896158V → I1 PublicationCorresponds to variant dbSNP:rs11570605EnsemblClinVar.1
Natural variantiVAR_01896263R → G1 PublicationCorresponds to variant dbSNP:rs11570606Ensembl.1
Natural variantiVAR_01896370R → Q1 PublicationCorresponds to variant dbSNP:rs11570607EnsemblClinVar.1
Natural variantiVAR_018964183D → N1 PublicationCorresponds to variant dbSNP:rs11570646Ensembl.1
Natural variantiVAR_029371310V → E in NBIA2A. 1 PublicationCorresponds to variant dbSNP:rs121908682EnsemblClinVar.1
Natural variantiVAR_018965343A → T1 PublicationCorresponds to variant dbSNP:rs11570680EnsemblClinVar.1
Natural variantiVAR_070600484D → G in NBIA2A. 1 Publication1
Natural variantiVAR_029372545K → T in NBIA2B. 1 PublicationCorresponds to variant dbSNP:rs121908681EnsemblClinVar.1
Natural variantiVAR_079753550R → W1 PublicationCorresponds to variant dbSNP:rs1004616610Ensembl.1
Natural variantiVAR_029373632R → W in NBIA2B. 1 PublicationCorresponds to variant dbSNP:rs121908683EnsemblClinVar.1
Natural variantiVAR_070601661T → M in NBIA2A. 1 PublicationCorresponds to variant dbSNP:rs767689496Ensembl.1
Natural variantiVAR_029374691Missing in NBIA2A. 2 Publications1
Natural variantiVAR_062530741R → Q in PARK14. 1 PublicationCorresponds to variant dbSNP:rs121908686EnsemblClinVar.1
Natural variantiVAR_062531747R → W in PARK14. 1 PublicationCorresponds to variant dbSNP:rs121908687EnsemblClinVar.1
Natural variantiVAR_037903774S → T. Corresponds to variant dbSNP:rs34184838Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00027771 – 142Missing in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_000278396 – 450LVTRK…LNNLE → Q in isoform SH-iPLA2. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_000279450 – 499ELQDL…QLLIA → GSHPSQAGWWAWGAVSDGTT GSHAHLTGPEASVHPGLHEG READMQNLSP in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_000281477 – 479HDH → CRT in isoform Ankyrin-iPLA2-1. 1 Publication3
Alternative sequenceiVSP_000282480 – 806Missing in isoform Ankyrin-iPLA2-1. 1 PublicationAdd BLAST327
Alternative sequenceiVSP_000280500 – 806Missing in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST307

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064594 mRNA Translation: AAC97486.1
AF102988 mRNA Translation: AAD41722.1
AF102989 mRNA Translation: AAD41723.1
AF117692
, AF117677, AF117678, AF117679, AF117680, AF117681, AF117682, AF117683, AF117684, AF117685, AF117686, AF117687, AF117688, AF117689, AF117690, AF117691 Genomic DNA Translation: AAD30424.1
AF116267
, AF116252, AF116253, AF116254, AF116255, AF116256, AF116257, AF116258, AF116259, AF116260, AF116261, AF116262, AF116263, AF116264, AF116265, AF116266 Genomic DNA Translation: AAF34728.1
AL080187 mRNA Translation: CAB45768.2
CR456543 mRNA Translation: CAG30429.1
AY522921 Genomic DNA Translation: AAR92478.1
AK291212 mRNA Translation: BAF83901.1
AL022322 Genomic DNA No translation available.
CH471095 Genomic DNA Translation: EAW60219.1
CH471095 Genomic DNA Translation: EAW60220.1
BC036742 mRNA Translation: AAH36742.2
BC051904 mRNA Translation: AAH51904.1
CCDSiCCDS13967.1 [O60733-1]
CCDS33645.1 [O60733-2]
RefSeqiNP_001004426.1, NM_001004426.1 [O60733-2]
NP_001186491.1, NM_001199562.1 [O60733-2]
NP_003551.2, NM_003560.2 [O60733-1]
XP_005261821.1, XM_005261764.2 [O60733-1]
XP_005261822.1, XM_005261765.1 [O60733-1]
XP_005261823.1, XM_005261766.1
XP_006724395.1, XM_006724332.3 [O60733-1]
XP_016884470.1, XM_017028981.1
XP_016884471.1, XM_017028982.1
XP_016884477.1, XM_017028988.1 [O60733-3]
UniGeneiHs.170479
Hs.641914

Genome annotation databases

EnsembliENST00000332509; ENSP00000333142; ENSG00000184381 [O60733-1]
ENST00000335539; ENSP00000335149; ENSG00000184381 [O60733-2]
ENST00000402064; ENSP00000386100; ENSG00000184381 [O60733-2]
GeneIDi8398
KEGGihsa:8398
UCSCiuc003auy.2 human [O60733-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064594 mRNA Translation: AAC97486.1
AF102988 mRNA Translation: AAD41722.1
AF102989 mRNA Translation: AAD41723.1
AF117692
, AF117677, AF117678, AF117679, AF117680, AF117681, AF117682, AF117683, AF117684, AF117685, AF117686, AF117687, AF117688, AF117689, AF117690, AF117691 Genomic DNA Translation: AAD30424.1
AF116267
, AF116252, AF116253, AF116254, AF116255, AF116256, AF116257, AF116258, AF116259, AF116260, AF116261, AF116262, AF116263, AF116264, AF116265, AF116266 Genomic DNA Translation: AAF34728.1
AL080187 mRNA Translation: CAB45768.2
CR456543 mRNA Translation: CAG30429.1
AY522921 Genomic DNA Translation: AAR92478.1
AK291212 mRNA Translation: BAF83901.1
AL022322 Genomic DNA No translation available.
CH471095 Genomic DNA Translation: EAW60219.1
CH471095 Genomic DNA Translation: EAW60220.1
BC036742 mRNA Translation: AAH36742.2
BC051904 mRNA Translation: AAH51904.1
CCDSiCCDS13967.1 [O60733-1]
CCDS33645.1 [O60733-2]
RefSeqiNP_001004426.1, NM_001004426.1 [O60733-2]
NP_001186491.1, NM_001199562.1 [O60733-2]
NP_003551.2, NM_003560.2 [O60733-1]
XP_005261821.1, XM_005261764.2 [O60733-1]
XP_005261822.1, XM_005261765.1 [O60733-1]
XP_005261823.1, XM_005261766.1
XP_006724395.1, XM_006724332.3 [O60733-1]
XP_016884470.1, XM_017028981.1
XP_016884471.1, XM_017028982.1
XP_016884477.1, XM_017028988.1 [O60733-3]
UniGeneiHs.170479
Hs.641914

3D structure databases

ProteinModelPortaliO60733
SMRiO60733
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113986, 5 interactors
IntActiO60733, 11 interactors
STRINGi9606.ENSP00000333142

Chemistry databases

BindingDBiO60733
ChEMBLiCHEMBL3213
DrugBankiDB01103 Quinacrine
SwissLipidsiSLP:000000618

PTM databases

iPTMnetiO60733
PhosphoSitePlusiO60733

Polymorphism and mutation databases

BioMutaiPLA2G6

Proteomic databases

EPDiO60733
MaxQBiO60733
PaxDbiO60733
PeptideAtlasiO60733
PRIDEiO60733
ProteomicsDBi49578
49579 [O60733-2]
49580 [O60733-3]
49581 [O60733-4]

Protocols and materials databases

DNASUi8398
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332509; ENSP00000333142; ENSG00000184381 [O60733-1]
ENST00000335539; ENSP00000335149; ENSG00000184381 [O60733-2]
ENST00000402064; ENSP00000386100; ENSG00000184381 [O60733-2]
GeneIDi8398
KEGGihsa:8398
UCSCiuc003auy.2 human [O60733-1]

Organism-specific databases

CTDi8398
DisGeNETi8398
EuPathDBiHostDB:ENSG00000184381.18
GeneCardsiPLA2G6
GeneReviewsiPLA2G6
HGNCiHGNC:9039 PLA2G6
HPAiHPA001171
MalaCardsiPLA2G6
MIMi256600 phenotype
603604 gene
610217 phenotype
612953 phenotype
neXtProtiNX_O60733
OpenTargetsiENSG00000184381
Orphaneti199351 Adult-onset dystonia-parkinsonism
35069 Infantile neuroaxonal dystrophy
PharmGKBiPA33367
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0513 Eukaryota
COG0666 LUCA
COG3621 LUCA
GeneTreeiENSGT00530000063645
HOVERGENiHBG053482
InParanoidiO60733
KOiK16343
OMAiQREHIEN
OrthoDBiEOG091G042U
PhylomeDBiO60733
TreeFamiTF319230

Enzyme and pathway databases

BRENDAi3.1.1.4 2681
ReactomeiR-HSA-1482788 Acyl chain remodelling of PC
R-HSA-1482798 Acyl chain remodeling of CL
R-HSA-1482839 Acyl chain remodelling of PE
R-HSA-2029485 Role of phospholipids in phagocytosis
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic

Miscellaneous databases

ChiTaRSiPLA2G6 human
GeneWikiiPLA2G6
GenomeRNAii8398
PMAP-CutDBiO60733
PROiPR:O60733
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000184381 Expressed in 188 organ(s), highest expression level in right uterine tube
CleanExiHS_PLA2G6
ExpressionAtlasiO60733 baseline and differential
GenevisibleiO60733 HS

Family and domain databases

CDDicd00204 ANK, 3 hits
Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR016035 Acyl_Trfase/lysoPLipase
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR002641 PNPLA_dom
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF01734 Patatin, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF52151 SSF52151, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits
PS51635 PNPLA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPLPL9_HUMAN
AccessioniPrimary (citable) accession number: O60733
Secondary accession number(s): A8K597
, B0QYE8, O75645, Q8N452, Q9UG29, Q9UIT0, Q9Y671
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: September 12, 2018
This is version 188 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Pharmaceutical, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again