Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 197 (13 Nov 2019)
Sequence version 2 (30 May 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

85/88 kDa calcium-independent phospholipase A2

Gene

PLA2G6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.
Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by calcium-activated calmodulin.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei519NucleophilePROSITE-ProRule annotation1
Active sitei652Proton acceptorPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Hydrolase
Biological processChemotaxis, Lipid degradation, Lipid metabolism

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.1.4 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1482788 Acyl chain remodelling of PC
R-HSA-1482798 Acyl chain remodeling of CL
R-HSA-1482839 Acyl chain remodelling of PE
R-HSA-2029485 Role of phospholipids in phagocytosis
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000618

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
Short name:
CaI-PLA2
Alternative name(s):
Group VI phospholipase A2
Short name:
GVI PLA2
Intracellular membrane-associated calcium-independent phospholipase A2 beta
Short name:
iPLA2-beta
Patatin-like phospholipase domain-containing protein 9
Short name:
PNPLA9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLA2G6
Synonyms:PLPLA9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9039 PLA2G6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603604 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O60733

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Neurodegeneration with brain iron accumulation 2B (NBIA2B)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA neurodegenerative disorder associated with iron accumulation in the brain, primarily in the basal ganglia. It is characterized by progressive extrapyramidal dysfunction leading to rigidity, dystonia, dysarthria and sensorimotor impairment.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_029372545K → T in NBIA2B. 1 PublicationCorresponds to variant dbSNP:rs121908681EnsemblClinVar.1
Natural variantiVAR_029373632R → W in NBIA2B. 1 PublicationCorresponds to variant dbSNP:rs121908683EnsemblClinVar.1
Neurodegeneration with brain iron accumulation 2A (NBIA2A)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA neurodegenerative disease characterized by pathologic axonal swelling and spheroid bodies in the central nervous system. Onset is within the first 2 years of life with death by age 10 years.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029371310V → E in NBIA2A. 1 PublicationCorresponds to variant dbSNP:rs121908682EnsemblClinVar.1
Natural variantiVAR_070600484D → G in NBIA2A. 1 Publication1
Natural variantiVAR_070601661T → M in NBIA2A. 1 PublicationCorresponds to variant dbSNP:rs767689496Ensembl.1
Natural variantiVAR_029374691Missing in NBIA2A. 2 Publications1
Parkinson disease 14 (PARK14)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn adult-onset progressive neurodegenerative disorder characterized by parkinsonism, dystonia, severe cognitive decline, cerebral and cerebellar atrophy and absent iron in the basal ganglia on magnetic resonance imaging.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_062530741R → Q in PARK14. 1 PublicationCorresponds to variant dbSNP:rs121908686EnsemblClinVar.1
Natural variantiVAR_062531747R → W in PARK14. 1 PublicationCorresponds to variant dbSNP:rs121908687EnsemblClinVar.1

<p>This subsection of the ‘Pathology and Biotech’ section describes the use of a protein as a pharmaceutical drug. It indicates the name of the drug, the name of the firm that commercializes it and explains in a few words in which context the drug is used. In some cases, drugs that are under development are also described.<p><a href='/help/pharmaceutical_use' target='_top'>More...</a></p>Pharmaceutical usei

Potential target for therapeutic intervention of Barth syndrome.

Keywords - Diseasei

Disease mutation, Dystonia, Neurodegeneration, Parkinson disease, Parkinsonism

Organism-specific databases

DisGeNET

More...
DisGeNETi
8398

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
PLA2G6

MalaCards human disease database

More...
MalaCardsi
PLA2G6
MIMi256600 phenotype
610217 phenotype
612953 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000184381

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
199351 Adult-onset dystonia-parkinsonism
35069 Infantile neuroaxonal dystrophy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33367

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O60733

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3213

Drug and drug target database

More...
DrugBanki
DB01103 Quinacrine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLA2G6

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000670371 – 80685/88 kDa calcium-independent phospholipase A2Add BLAST806

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O60733

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O60733

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O60733

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O60733

PeptideAtlas

More...
PeptideAtlasi
O60733

PRoteomics IDEntifications database

More...
PRIDEi
O60733

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
49578 [O60733-1]
49579 [O60733-2]
49580 [O60733-3]
49581 [O60733-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O60733

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O60733

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
O60733

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Four different transcripts were found to be expressed in a distinct tissue distribution.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000184381 Expressed in 188 organ(s), highest expression level in right uterine tube

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O60733 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O60733 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001171

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms large oligomeric 270-350 kDa structures.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113986, 6 interactors

Protein interaction database and analysis system

More...
IntActi
O60733, 12 interactors

Molecular INTeraction database

More...
MINTi
O60733

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000333142

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O60733

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O60733

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati151 – 181ANK 1Add BLAST31
Repeati185 – 215ANK 2Add BLAST31
Repeati219 – 248ANK 3Add BLAST30
Repeati251 – 281ANK 4Add BLAST31
Repeati286 – 312ANK 5Add BLAST27
Repeati316 – 345ANK 6Add BLAST30
Repeati349 – 378ANK 7Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini481 – 665PNPLAPROSITE-ProRule annotationAdd BLAST185

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni677 – 696Calmodulin-bindingBy similarityAdd BLAST20
Regioni748 – 759Calmodulin-bindingBy similarityAdd BLAST12

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi485 – 490GXGXXGPROSITE-ProRule annotation6
Motifi517 – 521GXSXGPROSITE-ProRule annotation5
Motifi652 – 654DGA/GPROSITE-ProRule annotation3

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0513 Eukaryota
COG0666 LUCA
COG3621 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158756

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O60733

KEGG Orthology (KO)

More...
KOi
K16343

Identification of Orthologs from Complete Genome Data

More...
OMAi
NYEAPEC

Database of Orthologous Groups

More...
OrthoDBi
841851at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O60733

TreeFam database of animal gene trees

More...
TreeFami
TF319230

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016035 Acyl_Trfase/lysoPLipase
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR002641 PNPLA_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 1 hit
PF01734 Patatin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit
SSF52151 SSF52151, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits
PS51635 PNPLA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform LH-iPLA2 (identifier: O60733-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQFFGRLVNT FSGVTNLFSN PFRVKEVAVA DYTSSDRVRE EGQLILFQNT
60 70 80 90 100
PNRTWDCVLV NPRNSQSGFR LFQLELEADA LVNFHQYSSQ LLPFYESSPQ
110 120 130 140 150
VLHTEVLQHL TDLIRNHPSW SVAHLAVELG IRECFHHSRI ISCANCAENE
160 170 180 190 200
EGCTPLHLAC RKGDGEILVE LVQYCHTQMD VTDYKGETVF HYAVQGDNSQ
210 220 230 240 250
VLQLLGRNAV AGLNQVNNQG LTPLHLACQL GKQEMVRVLL LCNARCNIMG
260 270 280 290 300
PNGYPIHSAM KFSQKGCAEM IISMDSSQIH SKDPRYGASP LHWAKNAEMA
310 320 330 340 350
RMLLKRGCNV NSTSSAGNTA LHVAVMRNRF DCAIVLLTHG ANADARGEHG
360 370 380 390 400
NTPLHLAMSK DNVEMIKALI VFGAEVDTPN DFGETPTFLA SKIGRLVTRK
410 420 430 440 450
AILTLLRTVG AEYCFPPIHG VPAEQGSAAP HHPFSLERAQ PPPISLNNLE
460 470 480 490 500
LQDLMHISRA RKPAFILGSM RDEKRTHDHL LCLDGGGVKG LIIIQLLIAI
510 520 530 540 550
EKASGVATKD LFDWVAGTST GGILALAILH SKSMAYMRGM YFRMKDEVFR
560 570 580 590 600
GSRPYESGPL EEFLKREFGE HTKMTDVRKP KVMLTGTLSD RQPAELHLFR
610 620 630 640 650
NYDAPETVRE PRFNQNVNLR PPAQPSDQLV WRAARSSGAA PTYFRPNGRF
660 670 680 690 700
LDGGLLANNP TLDAMTEIHE YNQDLIRKGQ ANKVKKLSIV VSLGTGRSPQ
710 720 730 740 750
VPVTCVDVFR PSNPWELAKT VFGAKELGKM VVDCCTDPDG RAVDRARAWC
760 770 780 790 800
EMVGIQYFRL NPQLGTDIML DEVSDTVLVN ALWETEVYIY EHREEFQKLI

QLLLSP
Length:806
Mass (Da):89,903
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8E55CD4EB9ACAD8B
GO
Isoform SH-iPLA2 (identifier: O60733-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-450: LVTRKAILTLLRTVGAEYCFPPIHGVPAEQGSAAPHHPFSLERAQPPPISLNNLE → Q

Show »
Length:752
Mass (Da):84,093
Checksum:iF1C46C9380332E1D
GO
Isoform Ankyrin-iPLA2-1 (identifier: O60733-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     477-479: HDH → CRT
     480-806: Missing.

Show »
Length:479
Mass (Da):53,216
Checksum:i2C849808049DD065
GO
Isoform Ankyrin-iPLA2-2 (identifier: O60733-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-142: Missing.
     450-499: ELQDLMHISR...GLIIIQLLIA → GSHPSQAGWW...READMQNLSP
     500-806: Missing.

Show »
Length:427
Mass (Da):46,484
Checksum:i52DAEBA2EDDC4C31
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C3P5H7C3P5_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
168Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EX67E7EX67_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
226Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QYE9B0QYE9_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7G5H0Y7G5_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1Q9M0R1Q9_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y6T3H0Y6T3_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
439Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEN3F8WEN3_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEQ9F8WEQ9_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R3D9M0R3D9_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UJC7A0A590UJC7_HUMAN
85/88 kDa calcium-independent phosp...
PLA2G6
760Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti11F → S in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti64N → D in AAD41722 (PubMed:10092647).Curated1
Sequence conflicti64N → D in AAD41723 (PubMed:10092647).Curated1
Sequence conflicti579K → I in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti686K → I in AAD30424 (PubMed:10336645).Curated1
Sequence conflicti801Q → H in AAC97486 (PubMed:9417066).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01896158V → I1 PublicationCorresponds to variant dbSNP:rs11570605EnsemblClinVar.1
Natural variantiVAR_01896263R → G1 PublicationCorresponds to variant dbSNP:rs11570606Ensembl.1
Natural variantiVAR_01896370R → Q1 PublicationCorresponds to variant dbSNP:rs11570607EnsemblClinVar.1
Natural variantiVAR_018964183D → N1 PublicationCorresponds to variant dbSNP:rs11570646Ensembl.1
Natural variantiVAR_029371310V → E in NBIA2A. 1 PublicationCorresponds to variant dbSNP:rs121908682EnsemblClinVar.1
Natural variantiVAR_018965343A → T1 PublicationCorresponds to variant dbSNP:rs11570680EnsemblClinVar.1
Natural variantiVAR_070600484D → G in NBIA2A. 1 Publication1
Natural variantiVAR_029372545K → T in NBIA2B. 1 PublicationCorresponds to variant dbSNP:rs121908681EnsemblClinVar.1
Natural variantiVAR_079753550R → W1 PublicationCorresponds to variant dbSNP:rs1004616610Ensembl.1
Natural variantiVAR_029373632R → W in NBIA2B. 1 PublicationCorresponds to variant dbSNP:rs121908683EnsemblClinVar.1
Natural variantiVAR_070601661T → M in NBIA2A. 1 PublicationCorresponds to variant dbSNP:rs767689496Ensembl.1
Natural variantiVAR_029374691Missing in NBIA2A. 2 Publications1
Natural variantiVAR_062530741R → Q in PARK14. 1 PublicationCorresponds to variant dbSNP:rs121908686EnsemblClinVar.1
Natural variantiVAR_062531747R → W in PARK14. 1 PublicationCorresponds to variant dbSNP:rs121908687EnsemblClinVar.1
Natural variantiVAR_037903774S → T. Corresponds to variant dbSNP:rs34184838Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00027771 – 142Missing in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_000278396 – 450LVTRK…LNNLE → Q in isoform SH-iPLA2. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_000279450 – 499ELQDL…QLLIA → GSHPSQAGWWAWGAVSDGTT GSHAHLTGPEASVHPGLHEG READMQNLSP in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_000281477 – 479HDH → CRT in isoform Ankyrin-iPLA2-1. 1 Publication3
Alternative sequenceiVSP_000282480 – 806Missing in isoform Ankyrin-iPLA2-1. 1 PublicationAdd BLAST327
Alternative sequenceiVSP_000280500 – 806Missing in isoform Ankyrin-iPLA2-2. 1 PublicationAdd BLAST307

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF064594 mRNA Translation: AAC97486.1
AF102988 mRNA Translation: AAD41722.1
AF102989 mRNA Translation: AAD41723.1
AF117692
, AF117677, AF117678, AF117679, AF117680, AF117681, AF117682, AF117683, AF117684, AF117685, AF117686, AF117687, AF117688, AF117689, AF117690, AF117691 Genomic DNA Translation: AAD30424.1
AF116267
, AF116252, AF116253, AF116254, AF116255, AF116256, AF116257, AF116258, AF116259, AF116260, AF116261, AF116262, AF116263, AF116264, AF116265, AF116266 Genomic DNA Translation: AAF34728.1
AL080187 mRNA Translation: CAB45768.2
CR456543 mRNA Translation: CAG30429.1
AY522921 Genomic DNA Translation: AAR92478.1
AK291212 mRNA Translation: BAF83901.1
AL022322 Genomic DNA No translation available.
CH471095 Genomic DNA Translation: EAW60219.1
CH471095 Genomic DNA Translation: EAW60220.1
BC036742 mRNA Translation: AAH36742.2
BC051904 mRNA Translation: AAH51904.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13967.1 [O60733-1]
CCDS33645.1 [O60733-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001004426.1, NM_001004426.1 [O60733-2]
NP_001186491.1, NM_001199562.1 [O60733-2]
NP_003551.2, NM_003560.2 [O60733-1]
XP_005261821.1, XM_005261764.2
XP_005261822.1, XM_005261765.1
XP_005261823.1, XM_005261766.1
XP_006724395.1, XM_006724332.3
XP_016884470.1, XM_017028981.1
XP_016884471.1, XM_017028982.1
XP_016884477.1, XM_017028988.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000332509; ENSP00000333142; ENSG00000184381 [O60733-1]
ENST00000335539; ENSP00000335149; ENSG00000184381 [O60733-2]
ENST00000402064; ENSP00000386100; ENSG00000184381 [O60733-2]
ENST00000660610; ENSP00000499555; ENSG00000184381 [O60733-1]
ENST00000663895; ENSP00000499712; ENSG00000184381 [O60733-1]
ENST00000667521; ENSP00000499665; ENSG00000184381 [O60733-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8398

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8398

UCSC genome browser

More...
UCSCi
uc003auy.2 human [O60733-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064594 mRNA Translation: AAC97486.1
AF102988 mRNA Translation: AAD41722.1
AF102989 mRNA Translation: AAD41723.1
AF117692
, AF117677, AF117678, AF117679, AF117680, AF117681, AF117682, AF117683, AF117684, AF117685, AF117686, AF117687, AF117688, AF117689, AF117690, AF117691 Genomic DNA Translation: AAD30424.1
AF116267
, AF116252, AF116253, AF116254, AF116255, AF116256, AF116257, AF116258, AF116259, AF116260, AF116261, AF116262, AF116263, AF116264, AF116265, AF116266 Genomic DNA Translation: AAF34728.1
AL080187 mRNA Translation: CAB45768.2
CR456543 mRNA Translation: CAG30429.1
AY522921 Genomic DNA Translation: AAR92478.1
AK291212 mRNA Translation: BAF83901.1
AL022322 Genomic DNA No translation available.
CH471095 Genomic DNA Translation: EAW60219.1
CH471095 Genomic DNA Translation: EAW60220.1
BC036742 mRNA Translation: AAH36742.2
BC051904 mRNA Translation: AAH51904.1
CCDSiCCDS13967.1 [O60733-1]
CCDS33645.1 [O60733-2]
RefSeqiNP_001004426.1, NM_001004426.1 [O60733-2]
NP_001186491.1, NM_001199562.1 [O60733-2]
NP_003551.2, NM_003560.2 [O60733-1]
XP_005261821.1, XM_005261764.2
XP_005261822.1, XM_005261765.1
XP_005261823.1, XM_005261766.1
XP_006724395.1, XM_006724332.3
XP_016884470.1, XM_017028981.1
XP_016884471.1, XM_017028982.1
XP_016884477.1, XM_017028988.1

3D structure databases

SMRiO60733
ModBaseiSearch...

Protein-protein interaction databases

BioGridi113986, 6 interactors
IntActiO60733, 12 interactors
MINTiO60733
STRINGi9606.ENSP00000333142

Chemistry databases

BindingDBiO60733
ChEMBLiCHEMBL3213
DrugBankiDB01103 Quinacrine
SwissLipidsiSLP:000000618

PTM databases

iPTMnetiO60733
PhosphoSitePlusiO60733

Polymorphism and mutation databases

BioMutaiPLA2G6

Proteomic databases

jPOSTiO60733
MassIVEiO60733
MaxQBiO60733
PaxDbiO60733
PeptideAtlasiO60733
PRIDEiO60733
ProteomicsDBi49578 [O60733-1]
49579 [O60733-2]
49580 [O60733-3]
49581 [O60733-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
8398

Genome annotation databases

EnsembliENST00000332509; ENSP00000333142; ENSG00000184381 [O60733-1]
ENST00000335539; ENSP00000335149; ENSG00000184381 [O60733-2]
ENST00000402064; ENSP00000386100; ENSG00000184381 [O60733-2]
ENST00000660610; ENSP00000499555; ENSG00000184381 [O60733-1]
ENST00000663895; ENSP00000499712; ENSG00000184381 [O60733-1]
ENST00000667521; ENSP00000499665; ENSG00000184381 [O60733-1]
GeneIDi8398
KEGGihsa:8398
UCSCiuc003auy.2 human [O60733-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8398
DisGeNETi8398

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLA2G6
GeneReviewsiPLA2G6
HGNCiHGNC:9039 PLA2G6
HPAiHPA001171
MalaCardsiPLA2G6
MIMi256600 phenotype
603604 gene
610217 phenotype
612953 phenotype
neXtProtiNX_O60733
OpenTargetsiENSG00000184381
Orphaneti199351 Adult-onset dystonia-parkinsonism
35069 Infantile neuroaxonal dystrophy
PharmGKBiPA33367

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0513 Eukaryota
COG0666 LUCA
COG3621 LUCA
GeneTreeiENSGT00940000158756
InParanoidiO60733
KOiK16343
OMAiNYEAPEC
OrthoDBi841851at2759
PhylomeDBiO60733
TreeFamiTF319230

Enzyme and pathway databases

BRENDAi3.1.1.4 2681
ReactomeiR-HSA-1482788 Acyl chain remodelling of PC
R-HSA-1482798 Acyl chain remodeling of CL
R-HSA-1482839 Acyl chain remodelling of PE
R-HSA-2029485 Role of phospholipids in phagocytosis
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLA2G6 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PLA2G6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8398
PharosiO60733
PMAP-CutDBiO60733

Protein Ontology

More...
PROi
PR:O60733

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000184381 Expressed in 188 organ(s), highest expression level in right uterine tube
ExpressionAtlasiO60733 baseline and differential
GenevisibleiO60733 HS

Family and domain databases

Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR016035 Acyl_Trfase/lysoPLipase
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR002641 PNPLA_dom
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF01734 Patatin, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF52151 SSF52151, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits
PS51635 PNPLA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLPL9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O60733
Secondary accession number(s): A8K597
, B0QYE8, O75645, Q8N452, Q9UG29, Q9UIT0, Q9Y671
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 30, 2000
Last modified: November 13, 2019
This is version 197 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Pharmaceutical, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again