Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase CDC14B

Gene

CDC14B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Dual-specificity phosphatase involved in DNA damage response. Essential regulator of the G2 DNA damage checkpoint: following DNA damage, translocates to the nucleus and dephosphorylates FZR1/CDH1, a key activator of the anaphase promoting complex/cyclosome (APC/C). Dephosphorylates SIRT2 around early anaphase. Dephosphorylation of FZR1/CDH1 activates the APC/C, leading to the ubiquitination of PLK1, preventing entry into mitosis. Preferentially dephosphorylates proteins modified by proline-directed kinases.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei314Phosphocysteine intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
Biological processDNA damage, DNA repair

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5687128 MAPK6/MAPK4 signaling

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O60729

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dual specificity protein phosphatase CDC14B (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
CDC14 cell division cycle 14 homolog B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDC14B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000081377.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1719 CDC14B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603505 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O60729

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8555

Open Targets

More...
OpenTargetsi
ENSG00000081377

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26255

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDC14B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000948781 – 498Dual specificity protein phosphatase CDC14BAdd BLAST498

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O60729

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O60729

PeptideAtlas

More...
PeptideAtlasi
O60729

PRoteomics IDEntifications database

More...
PRIDEi
O60729

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49572
49573 [O60729-2]
49574 [O60729-3]
49575 [O60729-4]
49576 [O60729-5]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
O60729

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O60729

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O60729

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000081377 Expressed in 224 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_CDC14B

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O60729 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O60729 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA013312
HPA064747

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with FZR1/CDH1.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
SIRT2Q8IXJ62EBI-970231,EBI-477232

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114125, 118 interactors

Protein interaction database and analysis system

More...
IntActi
O60729, 17 interactors

Molecular INTeraction database

More...
MINTi
O60729

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000364389

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1498
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O60729

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O60729

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O60729

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni44 – 198AAdd BLAST155
Regioni199 – 212LinkerAdd BLAST14
Regioni213 – 379BAdd BLAST167

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1 – 54Nucleolar localization signalCuratedAdd BLAST54

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1720 Eukaryota
COG2453 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155950

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000198341

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050818

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O60729

KEGG Orthology (KO)

More...
KOi
K06639

Identification of Orthologs from Complete Genome Data

More...
OMAi
SPEAYIP

Database of Orthologous Groups

More...
OrthoDBi
EOG091G04FM

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O60729

TreeFam database of animal gene trees

More...
TreeFami
TF101053

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.190.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029260 DSPn
IPR000340 Dual-sp_phosphatase_cat-dom
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00782 DSPc, 1 hit
PF14671 DSPn, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00195 DSPc, 1 hit
SM00404 PTPc_motif, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: O60729-1) [UniParc]FASTAAdd to basket
Also known as: CDC14B2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKRKSERRSS WAAAPPCSRR CSSTSPGVKK IRSSTQQDPR RRDPQDDVYL
60 70 80 90 100
DITDRLCFAI LYSRPKSASN VHYFSIDNEL EYENFYADFG PLNLAMVYRY
110 120 130 140 150
CCKINKKLKS ITMLRKKIVH FTGSDQRKQA NAAFLVGCYM VIYLGRTPEE
160 170 180 190 200
AYRILIFGET SYIPFRDAAY GSCNFYITLL DCFHAVKKAM QYGFLNFNSF
210 220 230 240 250
NLDEYEHYEK AENGDLNWII PDRFIAFCGP HSRARLESGY HQHSPETYIQ
260 270 280 290 300
YFKNHNVTTI IRLNKRMYDA KRFTDAGFDH HDLFFADGST PTDAIVKEFL
310 320 330 340 350
DICENAEGAI AVHCKAGLGR TGTLIACYIM KHYRMTAAET IAWVRICRPG
360 370 380 390 400
SVIGPQQQFL VMKQTNLWLE GDYFRQKLKG QENGQHRAAF SKLLSGVDDI
410 420 430 440 450
SINGVENQDQ QEPEPYSDDD EINGVTQGDR LRALKSRRQS KTNAIPLTVI
460 470 480 490
LQSSVQSCKT SEPNISGSAG ITKRTTRSAS RKSSVKSLSI SRTKTVLR
Length:498
Mass (Da):56,802
Last modified:August 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCEE15EC4DC3B1DC7
GO
Isoform 1 (identifier: O60729-2) [UniParc]FASTAAdd to basket
Also known as: CDC14B1

The sequence of this isoform differs from the canonical sequence as follows:
     449-487: Missing.

Show »
Length:459
Mass (Da):52,752
Checksum:i7E5057E7677B2E61
GO
Isoform 3 (identifier: O60729-3) [UniParc]FASTAAdd to basket
Also known as: CDC14B3

The sequence of this isoform differs from the canonical sequence as follows:
     449-498: VILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR → DGWLSQAVTFLDRLLIWLGIHKD

Show »
Length:471
Mass (Da):54,176
Checksum:i7E55AF3DF2B39475
GO
Isoform 4 (identifier: O60729-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     449-498: VILQSSVQSC...SISRTKTVLR → CPLAVLTSAL...LFCLDGFRTQ

Show »
Length:485
Mass (Da):55,665
Checksum:i72641340642F981F
GO
Isoform 5 (identifier: O60729-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDIT → MSREGAGAALVAEVIK

Note: No experimental confirmation available.
Show »
Length:461
Mass (Da):52,311
Checksum:i94244A208280B2CB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C3U8H7C3U8_HUMAN
Dual-specificity protein phosphatas...
CDC14B
480Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JU07Q5JU07_HUMAN
Dual-specificity protein phosphatas...
CDC14B
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y577H0Y577_HUMAN
Dual-specificity protein phosphatas...
CDC14B
268Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019959302I → T1 PublicationCorresponds to variant dbSNP:rs16911114Ensembl.1
Natural variantiVAR_019960341I → T1 PublicationCorresponds to variant dbSNP:rs16911075Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0435761 – 53MKRKS…YLDIT → MSREGAGAALVAEVIK in isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_012039449 – 498VILQS…KTVLR → DGWLSQAVTFLDRLLIWLGI HKD in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_030720449 – 498VILQS…KTVLR → CPLAVLTSALCSVVIWWIVC DYILPILLFCLDGFRTQ in isoform 4. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_012038449 – 487Missing in isoform 1. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF023158 mRNA Translation: AAB88293.1
AF064104 mRNA Translation: AAC16661.1
AF064105 mRNA Translation: AAC16662.2
AK126388 mRNA Translation: BAG54321.1
EF611343 mRNA Translation: ABR12627.1
AY675321 Genomic DNA Translation: AAT70726.1
AL133477 Genomic DNA No translation available.
AL353578 Genomic DNA No translation available.
CH471174 Genomic DNA Translation: EAW92658.1
CH471174 Genomic DNA Translation: EAW92659.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43853.1 [O60729-5]
CCDS6721.1 [O60729-2]
CCDS6722.1 [O60729-1]
CCDS87662.1 [O60729-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001070649.1, NM_001077181.1 [O60729-5]
NP_003662.1, NM_003671.3 [O60729-2]
NP_201588.1, NM_033331.2 [O60729-1]
XP_011517460.1, XM_011519158.1
XP_016870732.1, XM_017015243.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.40582
Hs.729196
Hs.742127

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000375240; ENSP00000364388; ENSG00000081377 [O60729-2]
ENST00000375241; ENSP00000364389; ENSG00000081377 [O60729-1]
ENST00000375242; ENSP00000364390; ENSG00000081377 [O60729-5]
ENST00000463569; ENSP00000420572; ENSG00000081377 [O60729-4]
ENST00000474602; ENSP00000417897; ENSG00000081377 [O60729-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8555

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8555

UCSC genome browser

More...
UCSCi
uc004awi.4 human [O60729-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF023158 mRNA Translation: AAB88293.1
AF064104 mRNA Translation: AAC16661.1
AF064105 mRNA Translation: AAC16662.2
AK126388 mRNA Translation: BAG54321.1
EF611343 mRNA Translation: ABR12627.1
AY675321 Genomic DNA Translation: AAT70726.1
AL133477 Genomic DNA No translation available.
AL353578 Genomic DNA No translation available.
CH471174 Genomic DNA Translation: EAW92658.1
CH471174 Genomic DNA Translation: EAW92659.1
CCDSiCCDS43853.1 [O60729-5]
CCDS6721.1 [O60729-2]
CCDS6722.1 [O60729-1]
CCDS87662.1 [O60729-4]
RefSeqiNP_001070649.1, NM_001077181.1 [O60729-5]
NP_003662.1, NM_003671.3 [O60729-2]
NP_201588.1, NM_033331.2 [O60729-1]
XP_011517460.1, XM_011519158.1
XP_016870732.1, XM_017015243.1
UniGeneiHs.40582
Hs.729196
Hs.742127

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OHCX-ray2.50A39-386[»]
1OHDX-ray2.60A39-386[»]
1OHEX-ray2.20A39-386[»]
ProteinModelPortaliO60729
SMRiO60729
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114125, 118 interactors
IntActiO60729, 17 interactors
MINTiO60729
STRINGi9606.ENSP00000364389

PTM databases

DEPODiO60729
iPTMnetiO60729
PhosphoSitePlusiO60729

Polymorphism and mutation databases

BioMutaiCDC14B

Proteomic databases

EPDiO60729
PaxDbiO60729
PeptideAtlasiO60729
PRIDEiO60729
ProteomicsDBi49572
49573 [O60729-2]
49574 [O60729-3]
49575 [O60729-4]
49576 [O60729-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
8555
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375240; ENSP00000364388; ENSG00000081377 [O60729-2]
ENST00000375241; ENSP00000364389; ENSG00000081377 [O60729-1]
ENST00000375242; ENSP00000364390; ENSG00000081377 [O60729-5]
ENST00000463569; ENSP00000420572; ENSG00000081377 [O60729-4]
ENST00000474602; ENSP00000417897; ENSG00000081377 [O60729-3]
GeneIDi8555
KEGGihsa:8555
UCSCiuc004awi.4 human [O60729-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8555
DisGeNETi8555
EuPathDBiHostDB:ENSG00000081377.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDC14B
HGNCiHGNC:1719 CDC14B
HPAiHPA013312
HPA064747
MIMi603505 gene
neXtProtiNX_O60729
OpenTargetsiENSG00000081377
PharmGKBiPA26255

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1720 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00940000155950
HOGENOMiHOG000198341
HOVERGENiHBG050818
InParanoidiO60729
KOiK06639
OMAiSPEAYIP
OrthoDBiEOG091G04FM
PhylomeDBiO60729
TreeFamiTF101053

Enzyme and pathway databases

ReactomeiR-HSA-5687128 MAPK6/MAPK4 signaling
SIGNORiO60729

Miscellaneous databases

EvolutionaryTraceiO60729

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CDC14B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8555

Protein Ontology

More...
PROi
PR:O60729

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000081377 Expressed in 224 organ(s), highest expression level in corpus callosum
CleanExiHS_CDC14B
ExpressionAtlasiO60729 baseline and differential
GenevisibleiO60729 HS

Family and domain databases

Gene3Di3.90.190.10, 2 hits
InterProiView protein in InterPro
IPR029260 DSPn
IPR000340 Dual-sp_phosphatase_cat-dom
IPR029021 Prot-tyrosine_phosphatase-like
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR000387 TYR_PHOSPHATASE_dom
IPR020422 TYR_PHOSPHATASE_DUAL_dom
PfamiView protein in Pfam
PF00782 DSPc, 1 hit
PF14671 DSPn, 1 hit
SMARTiView protein in SMART
SM00195 DSPc, 1 hit
SM00404 PTPc_motif, 1 hit
SUPFAMiSSF52799 SSF52799, 2 hits
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50054 TYR_PHOSPHATASE_DUAL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC14B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O60729
Secondary accession number(s): A6N5X8
, A8MQ20, B1AL31, B1AL32, O43183, O60730, Q5JU08
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: August 1, 1998
Last modified: December 5, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again