Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

Gene

PDE8A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes (PubMed:18983167). May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development (PubMed:18983167). Binding to RAF1 reduces RAF1 'Ser-259' inhibitory-phosphorylation and stimulates RAF1-dependent EGF-activated ERK-signaling (PubMed:23509299). Protects against cell death induced by hydrogen peroxide and staurosporine (PubMed:23509299).2 Publications

Catalytic activityi

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.By similarity

Cofactori

a divalent metal cation1 PublicationNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.1 Publication

Activity regulationi

Inhibited by dipyridimole. Insensitive to selective PDE inhibitors including rolipram and zaprinast as well as to the non-selective inhibitor, IBMX. Unaffected by cGMP.By similarity

Pathwayi: 3',5'-cyclic AMP degradation

This protein is involved in step 1 of the subpathway that synthesizes AMP from 3',5'-cyclic AMP.
Proteins known to be involved in this subpathway in this organism are:
  1. cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10A), High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (PDE7A), High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B (PDE8B), cAMP-specific 3',5'-cyclic phosphodiesterase 7B (PDE7B), cAMP-specific 3',5'-cyclic phosphodiesterase 4B (PDE4B), cAMP-specific 3',5'-cyclic phosphodiesterase 4C (PDE4C), cAMP-specific 3',5'-cyclic phosphodiesterase 4D (PDE4D), High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (PDE8A), cAMP-specific 3',5'-cyclic phosphodiesterase 4A (PDE4A)
This subpathway is part of the pathway 3',5'-cyclic AMP degradation, which is itself part of Purine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes AMP from 3',5'-cyclic AMP, the pathway 3',5'-cyclic AMP degradation and in Purine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei556Proton donorBy similarity1
Metal bindingi560Divalent metal cation 1; via tele nitrogenCombined sources1 PublicationImported1
Metal bindingi596Divalent metal cation 1; via tele nitrogenCombined sources1 PublicationImported1
Metal bindingi597Divalent metal cation 1Combined sources1 PublicationImported1
Metal bindingi597Divalent metal cation 2Combined sources1 PublicationImported1
Metal bindingi726Divalent metal cation 1Combined sources1 PublicationImported1

GO - Molecular functioni

  • 3',5'-cyclic-AMP phosphodiesterase activity Source: UniProtKB
  • 3',5'-cyclic-GMP phosphodiesterase activity Source: UniProtKB
  • kinase binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionHydrolase
LigandcAMP, Metal-binding

Enzyme and pathway databases

BRENDAi3.1.4.53 2681
ReactomeiR-HSA-418555 G alpha (s) signalling events
UniPathwayi
UPA00762;UER00747

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (EC:3.1.4.53By similarity)
Gene namesi
Name:PDE8A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000073417.14
HGNCiHGNC:8793 PDE8A
MIMi602972 gene
neXtProtiNX_O60658

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi454 – 455RR → AA: Reduces interaction with RAF1; when associated with A-460 and A-461. 1 Publication2
Mutagenesisi460 – 461EY → AA: Reduces interaction with RAF1; when associated with A-454 and A-455. 1 Publication2
Mutagenesisi748Y → F: Increases sensitivity to several nonselective or family selective PDE inhibitors. 1 Publication1

Organism-specific databases

DisGeNETi5151
OpenTargetsiENSG00000073417
PharmGKBiPA33141

Chemistry databases

ChEMBLiCHEMBL4640
DrugBankiDB07954 3-isobutyl-1-methyl-7H-xanthine
DB00201 Caffeine
GuidetoPHARMACOLOGYi1307

Polymorphism and mutation databases

BioMutaiPDE8A

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001988381 – 829High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8AAdd BLAST829

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei20PhosphoserineCombined sources1
Modified residuei359Phosphoserine; by PKA1 Publication1
Modified residuei386PhosphoserineBy similarity1
Modified residuei457PhosphoserineCombined sources1
Modified residuei461PhosphotyrosineBy similarity1

Post-translational modificationi

Phosphorylated at Ser-359 by PKA under elevated cAMP conditions, this enhances catalytic activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO60658
MaxQBiO60658
PaxDbiO60658
PeptideAtlasiO60658
PRIDEiO60658
ProteomicsDBi49499
49500 [O60658-2]
49501 [O60658-3]
49502 [O60658-4]
49503 [O60658-5]

PTM databases

iPTMnetiO60658
PhosphoSitePlusiO60658

Expressioni

Tissue specificityi

Expressed in most tissues except thymus and peripheral blood leukocytes. Highest levels in testis, ovary, small intestine and colon.

Gene expression databases

BgeeiENSG00000073417 Expressed in 231 organ(s), highest expression level in corpus callosum
CleanExiHS_PDE8A
ExpressionAtlasiO60658 baseline and differential
GenevisibleiO60658 HS

Organism-specific databases

HPAiHPA007722

Interactioni

Subunit structurei

Interacts with RAF1. The interaction promotes RAF1 activity.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111177, 4 interactors
IntActiO60658, 2 interactors
STRINGi9606.ENSP00000311453

Chemistry databases

BindingDBiO60658

Structurei

Secondary structure

1829
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO60658
SMRiO60658
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO60658

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini213 – 283PASPROSITE-ProRule annotationAdd BLAST71
Domaini287 – 329PACAdd BLAST43
Domaini480 – 820PDEasePROSITE-ProRule annotationAdd BLAST341

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni454 – 461Involved in RAF1-binding1 Publication8

Domaini

Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1229 Eukaryota
ENOG410XP9B LUCA
GeneTreeiENSGT00760000118889
HOVERGENiHBG053544
KOiK18437
OMAiHYVSISR
OrthoDBiEOG091G0337
PhylomeDBiO60658
TreeFamiTF314638

Family and domain databases

CDDicd00077 HDc, 1 hit
cd00130 PAS, 1 hit
Gene3Di1.10.1300.10, 1 hit
InterProiView protein in InterPro
IPR003607 HD/PDEase_dom
IPR000014 PAS
IPR035965 PAS-like_dom_sf
IPR013767 PAS_fold
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS
PfamiView protein in Pfam
PF00989 PAS, 1 hit
PF00233 PDEase_I, 1 hit
PRINTSiPR00387 PDIESTERASE1
SMARTiView protein in SMART
SM00471 HDc, 1 hit
SUPFAMiSSF55785 SSF55785, 1 hit
TIGRFAMsiTIGR00229 sensory_box, 1 hit
PROSITEiView protein in PROSITE
PS50112 PAS, 1 hit
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O60658-1) [UniParc]FASTAAdd to basket
Also known as: PDE8A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGCAPSIHIS ERLVAEDAPS PAAPPLSSGG PRLPQGQKTA ALPRTRGAGL
60 70 80 90 100
LESELRDGSG KKVAVADVQF GPMRFHQDQL QVLLVFTKED NQCNGFCRAC
110 120 130 140 150
EKAGFKCTVT KEAQAVLACF LDKHHDIIII DHRNPRQLDA EALCRSIRSS
160 170 180 190 200
KLSENTVIVG VVRRVDREEL SVMPFISAGF TRRYVENPNI MACYNELLQL
210 220 230 240 250
EFGEVRSQLK LRACNSVFTA LENSEDAIEI TSEDRFIQYA NPAFETTMGY
260 270 280 290 300
QSGELIGKEL GEVPINEKKA DLLDTINSCI RIGKEWQGIY YAKKKNGDNI
310 320 330 340 350
QQNVKIIPVI GQGGKIRHYV SIIRVCNGNN KAEKISECVQ SDTHTDNQTG
360 370 380 390 400
KHKDRRKGSL DVKAVASRAT EVSSQRRHSS MARIHSMTIE APITKVINII
410 420 430 440 450
NAAQESSPMP VTEALDRVLE ILRTTELYSP QFGAKDDDPH ANDLVGGLMS
460 470 480 490 500
DGLRRLSGNE YVLSTKNTQM VSSNIITPIS LDDVPPRIAR AMENEEYWDF
510 520 530 540 550
DIFELEAATH NRPLIYLGLK MFARFGICEF LHCSESTLRS WLQIIEANYH
560 570 580 590 600
SSNPYHNSTH SADVLHATAY FLSKERIKET LDPIDEVAAL IAATIHDVDH
610 620 630 640 650
PGRTNSFLCN AGSELAILYN DTAVLESHHA ALAFQLTTGD DKCNIFKNME
660 670 680 690 700
RNDYRTLRQG IIDMVLATEM TKHFEHVNKF VNSINKPLAT LEENGETDKN
710 720 730 740 750
QEVINTMLRT PENRTLIKRM LIKCADVSNP CRPLQYCIEW AARISEEYFS
760 770 780 790 800
QTDEEKQQGL PVVMPVFDRN TCSIPKSQIS FIDYFITDMF DAWDAFVDLP
810 820
DLMQHLDNNF KYWKGLDEMK LRNLRPPPE
Length:829
Mass (Da):93,304
Last modified:September 19, 2002 - v2
Checksum:i99BD05EA185A42CD
GO
Isoform 2 (identifier: O60658-2) [UniParc]FASTAAdd to basket
Also known as: PDE8A2

The sequence of this isoform differs from the canonical sequence as follows:
     239-284: Missing.

Show »
Length:783
Mass (Da):88,293
Checksum:i67BB1FBE670D7EFE
GO
Isoform 3 (identifier: O60658-3) [UniParc]FASTAAdd to basket
Also known as: PDE8A3

The sequence of this isoform differs from the canonical sequence as follows:
     213-231: ACNSVFTALENSEDAIEIT → SGKEFTMQKRKTEIIYNKM
     232-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:231
Mass (Da):25,744
Checksum:iD7E21A8D19D661A6
GO
Isoform 4 (identifier: O60658-4) [UniParc]FASTAAdd to basket
Also known as: PDE8A4

The sequence of this isoform differs from the canonical sequence as follows:
     212-228: RACNSVFTALENSEDAI → SMQILHLKQQWAISQVN
     229-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:228
Mass (Da):25,279
Checksum:i4667A08AAA57F17F
GO
Isoform 5 (identifier: O60658-5) [UniParc]FASTAAdd to basket
Also known as: PDE8A5

The sequence of this isoform differs from the canonical sequence as follows:
     239-272: YANPAFETTMGYQSGELIGKELGEVPINEKKADL → PCCSSSWFGAAHIPSSAPVEVGVGLLPSWSLRRT
     273-829: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:272
Mass (Da):29,852
Checksum:iFEECE2A0C9115E13
GO
Isoform 6 (identifier: O60658-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Note: No experimental confirmation available.
Show »
Length:757
Mass (Da):86,049
Checksum:i66EB20F0822E42AC
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YKR1H0YKR1_HUMAN
High affinity cAMP-specific and IBM...
PDE8A
231Annotation score:
E9PIJ0E9PIJ0_HUMAN
High affinity cAMP-specific and IBM...
PDE8A
272Annotation score:
H0YNP3H0YNP3_HUMAN
High affinity cAMP-specific and IBM...
PDE8A
126Annotation score:

Sequence cautioni

The sequence AAL18612 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence AAL18613 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence AAL18614 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence BAG54458 differs from that shown. Intron retention.Curated
The sequence EAX01967 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti55L → V in AAK57641 (PubMed:11371644).Curated1
Sequence conflicti344H → R in AAK57641 (PubMed:11371644).Curated1
Sequence conflicti344H → R in AAC39763 (PubMed:9618252).Curated1
Sequence conflicti399I → V in AAK57641 (PubMed:11371644).Curated1
Sequence conflicti399I → V in AAC39763 (PubMed:9618252).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069109112E → G2 PublicationsCorresponds to variant dbSNP:rs17855018Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0460171 – 72Missing in isoform 6. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_041674212 – 228RACNS…SEDAI → SMQILHLKQQWAISQVN in isoform 4. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_041675213 – 231ACNSV…AIEIT → SGKEFTMQKRKTEIIYNKM in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_041676229 – 829Missing in isoform 4. 1 PublicationAdd BLAST601
Alternative sequenceiVSP_041677232 – 829Missing in isoform 3. 1 PublicationAdd BLAST598
Alternative sequenceiVSP_004597239 – 284Missing in isoform 2. 2 PublicationsAdd BLAST46
Alternative sequenceiVSP_041678239 – 272YANPA…KKADL → PCCSSSWFGAAHIPSSAPVE VGVGLLPSWSLRRT in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_041679273 – 829Missing in isoform 5. 1 PublicationAdd BLAST557

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388183 mRNA Translation: AAL18610.1
AF388184 mRNA Translation: AAL18611.1
AF388185 mRNA Translation: AAL18612.1 Sequence problems.
AF388186 mRNA Translation: AAL18613.1 Sequence problems.
AF388187 mRNA Translation: AAL18614.1 Sequence problems.
AF332653 mRNA Translation: AAK57641.1
AK074280 mRNA No translation available.
AK127232 mRNA Translation: BAG54458.1 Sequence problems.
AC027078 Genomic DNA No translation available.
AC087468 Genomic DNA No translation available.
CH471101 Genomic DNA Translation: EAX01967.1 Sequence problems.
BC060762 mRNA Translation: AAH60762.1
BC075822 mRNA Translation: AAH75822.1
AF056490 mRNA Translation: AAC39763.1
AL109687 mRNA Translation: CAB52020.1
AL109778 mRNA Translation: CAB52432.1
CCDSiCCDS10336.1 [O60658-1]
CCDS10337.1 [O60658-2]
CCDS58397.1 [O60658-6]
PIRiJW0088
RefSeqiNP_001230066.1, NM_001243137.1 [O60658-6]
NP_002596.1, NM_002605.2 [O60658-1]
NP_775656.1, NM_173454.1 [O60658-2]
XP_016877800.1, XM_017022311.1
UniGeneiHs.9333

Genome annotation databases

EnsembliENST00000310298; ENSP00000311453; ENSG00000073417 [O60658-1]
ENST00000339708; ENSP00000340679; ENSG00000073417 [O60658-2]
ENST00000394553; ENSP00000378056; ENSG00000073417 [O60658-1]
ENST00000478717; ENSP00000432309; ENSG00000073417 [O60658-4]
ENST00000557957; ENSP00000453808; ENSG00000073417 [O60658-6]
GeneIDi5151
KEGGihsa:5151
UCSCiuc002blh.4 human [O60658-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388183 mRNA Translation: AAL18610.1
AF388184 mRNA Translation: AAL18611.1
AF388185 mRNA Translation: AAL18612.1 Sequence problems.
AF388186 mRNA Translation: AAL18613.1 Sequence problems.
AF388187 mRNA Translation: AAL18614.1 Sequence problems.
AF332653 mRNA Translation: AAK57641.1
AK074280 mRNA No translation available.
AK127232 mRNA Translation: BAG54458.1 Sequence problems.
AC027078 Genomic DNA No translation available.
AC087468 Genomic DNA No translation available.
CH471101 Genomic DNA Translation: EAX01967.1 Sequence problems.
BC060762 mRNA Translation: AAH60762.1
BC075822 mRNA Translation: AAH75822.1
AF056490 mRNA Translation: AAC39763.1
AL109687 mRNA Translation: CAB52020.1
AL109778 mRNA Translation: CAB52432.1
CCDSiCCDS10336.1 [O60658-1]
CCDS10337.1 [O60658-2]
CCDS58397.1 [O60658-6]
PIRiJW0088
RefSeqiNP_001230066.1, NM_001243137.1 [O60658-6]
NP_002596.1, NM_002605.2 [O60658-1]
NP_775656.1, NM_173454.1 [O60658-2]
XP_016877800.1, XM_017022311.1
UniGeneiHs.9333

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LHQmodel-A482-821[»]
1LXXmodel-A488-821[»]
3ECMX-ray1.90A482-819[»]
3ECNX-ray2.10A/B482-819[»]
ProteinModelPortaliO60658
SMRiO60658
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111177, 4 interactors
IntActiO60658, 2 interactors
STRINGi9606.ENSP00000311453

Chemistry databases

BindingDBiO60658
ChEMBLiCHEMBL4640
DrugBankiDB07954 3-isobutyl-1-methyl-7H-xanthine
DB00201 Caffeine
GuidetoPHARMACOLOGYi1307

PTM databases

iPTMnetiO60658
PhosphoSitePlusiO60658

Polymorphism and mutation databases

BioMutaiPDE8A

Proteomic databases

EPDiO60658
MaxQBiO60658
PaxDbiO60658
PeptideAtlasiO60658
PRIDEiO60658
ProteomicsDBi49499
49500 [O60658-2]
49501 [O60658-3]
49502 [O60658-4]
49503 [O60658-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000310298; ENSP00000311453; ENSG00000073417 [O60658-1]
ENST00000339708; ENSP00000340679; ENSG00000073417 [O60658-2]
ENST00000394553; ENSP00000378056; ENSG00000073417 [O60658-1]
ENST00000478717; ENSP00000432309; ENSG00000073417 [O60658-4]
ENST00000557957; ENSP00000453808; ENSG00000073417 [O60658-6]
GeneIDi5151
KEGGihsa:5151
UCSCiuc002blh.4 human [O60658-1]

Organism-specific databases

CTDi5151
DisGeNETi5151
EuPathDBiHostDB:ENSG00000073417.14
GeneCardsiPDE8A
H-InvDBiHIX0012539
HGNCiHGNC:8793 PDE8A
HPAiHPA007722
MIMi602972 gene
neXtProtiNX_O60658
OpenTargetsiENSG00000073417
PharmGKBiPA33141
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1229 Eukaryota
ENOG410XP9B LUCA
GeneTreeiENSGT00760000118889
HOVERGENiHBG053544
KOiK18437
OMAiHYVSISR
OrthoDBiEOG091G0337
PhylomeDBiO60658
TreeFamiTF314638

Enzyme and pathway databases

UniPathwayi
UPA00762;UER00747

BRENDAi3.1.4.53 2681
ReactomeiR-HSA-418555 G alpha (s) signalling events

Miscellaneous databases

ChiTaRSiPDE8A human
EvolutionaryTraceiO60658
GeneWikiiPDE8A
GenomeRNAii5151
PROiPR:O60658
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000073417 Expressed in 231 organ(s), highest expression level in corpus callosum
CleanExiHS_PDE8A
ExpressionAtlasiO60658 baseline and differential
GenevisibleiO60658 HS

Family and domain databases

CDDicd00077 HDc, 1 hit
cd00130 PAS, 1 hit
Gene3Di1.10.1300.10, 1 hit
InterProiView protein in InterPro
IPR003607 HD/PDEase_dom
IPR000014 PAS
IPR035965 PAS-like_dom_sf
IPR013767 PAS_fold
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS
PfamiView protein in Pfam
PF00989 PAS, 1 hit
PF00233 PDEase_I, 1 hit
PRINTSiPR00387 PDIESTERASE1
SMARTiView protein in SMART
SM00471 HDc, 1 hit
SUPFAMiSSF55785 SSF55785, 1 hit
TIGRFAMsiTIGR00229 sensory_box, 1 hit
PROSITEiView protein in PROSITE
PS50112 PAS, 1 hit
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPDE8A_HUMAN
AccessioniPrimary (citable) accession number: O60658
Secondary accession number(s): B3KXE6
, H0YMZ7, Q6P9H3, Q969I1, Q96PC9, Q96PD0, Q96PD1, Q96T71, Q9UMB7, Q9UMC3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: September 19, 2002
Last modified: November 7, 2018
This is version 188 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again