Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 216 (10 Feb 2021)
Sequence version 5 (17 Oct 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Kinesin-like protein KIF1B

Gene

KIF1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Motor for anterograde transport of mitochondria. Has a microtubule plus end-directed motility. Isoform 2 is required for induction of neuronal apoptosis.1 Publication
Isoform 1 mediates the transport of synaptic vesicles in neuronal cells.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi97 – 104ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
Biological processApoptosis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
O60333

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6811434, COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189, Kinesins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kinesin-like protein KIF1B
Short name:
Klp
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KIF1B
Synonyms:KIAA0591, KIAA1448
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16636, KIF1B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605995, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O60333

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000054523.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Microtubule, Mitochondrion, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Charcot-Marie-Tooth disease 2A1 (CMT2A1)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA dominant axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies (designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal degeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01151598Q → L in CMT2A1. 1 PublicationCorresponds to variant dbSNP:rs121908160EnsemblClinVar.1
Neuroblastoma 1 (NBLST1)
Disease susceptibility is associated with variants affecting the gene represented in this entry.
Disease descriptionA common neoplasm of early childhood arising from embryonic cells that form the primitive neural crest and give rise to the adrenal medulla and the sympathetic nervous system.
Related information in OMIM
Pheochromocytoma (PCC)1 Publication
Disease susceptibility is associated with variants affecting the gene represented in this entry.
Disease descriptionA catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.
Related information in OMIM

Keywords - Diseasei

Charcot-Marie-Tooth disease, Disease variant, Neurodegeneration, Neuropathy

Organism-specific databases

DisGeNET

More...
DisGeNETi
23095

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
KIF1B

MalaCards human disease database

More...
MalaCardsi
KIF1B
MIMi118210, phenotype
171300, phenotype
256700, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000054523

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
99946, Autosomal dominant Charcot-Marie-Tooth disease type 2A1
29072, Hereditary pheochromocytoma-paraganglioma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38176

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O60333, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5889

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KIF1B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001254072 – 1816Kinesin-like protein KIF1BAdd BLAST1815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei647PhosphothreonineBy similarity1
Modified residuei652PhosphothreonineBy similarity1
Modified residuei1054PhosphoserineCombined sources1
Modified residuei1057PhosphoserineCombined sources1
Modified residuei1075PhosphothreonineCombined sources1
Modified residuei1416PhosphoserineCombined sources1
Modified residuei1454PhosphoserineCombined sources1
Modified residuei1487PhosphoserineCombined sources1
Modified residuei1573PhosphoserineCombined sources1
Modified residuei1603PhosphoserineCombined sources1
Modified residuei1610PhosphoserineCombined sources1
Modified residuei1613PhosphoserineCombined sources1
Isoform 3 (identifier: O60333-3)
Modified residuei663PhosphoserineCombined sources1
Modified residuei665PhosphoserineCombined sources1
Modified residuei1141PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O60333

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O60333

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O60333

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O60333

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O60333

PeptideAtlas

More...
PeptideAtlasi
O60333

PRoteomics IDEntifications database

More...
PRIDEi
O60333

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
49353 [O60333-1]
49354 [O60333-2]
49355 [O60333-3]
49356 [O60333-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O60333

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
O60333

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O60333

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O60333

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 3 is abundant in the skeletal muscle. It is also expressed in fetal brain, lung and kidney, and adult heart, placenta, testis, ovary and small intestine. Isoform 2 is abundant in the brain and also expressed in fetal heart, lung, liver and kidney, and adult skeletal muscle, placenta, liver, kidney, heart, spleen, thymus, prostate, testis, ovary, small intestine, colon and pancreas.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000054523, Expressed in skeletal muscle tissue of rectus abdominis and 235 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O60333, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O60333, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000054523, Tissue enhanced (skeletal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (By similarity).

Interacts (via C-terminus end of the kinesin-motor domain) with CHP1; the interaction occurs in a calcium-dependent manner (By similarity).

Interacts with KIFBP (PubMed:16225668).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

O60333
With#Exp.IntAct
CLASP1 [Q7Z460]3EBI-465633,EBI-913476
SIAH1 [Q8IUQ4]3EBI-465633,EBI-747107
Isoform 2 [O60333-2]
With#Exp.IntAct
ADAMTSL4 - isoform 3 [Q6UY14-3]3EBI-10975473,EBI-10173507
AGA [P20933]3EBI-10975473,EBI-1223922
ANKRD13D - isoform 2 [Q6ZTN6-2]3EBI-10975473,EBI-25840993
ANP32B [Q92688]3EBI-10975473,EBI-762428
ANXA8 [P13928]3EBI-10975473,EBI-2556915
APLN [D3DTF8]3EBI-10975473,EBI-22002556
APP [P05067]3EBI-10975473,EBI-77613
AQP8 [O94778]3EBI-10975473,EBI-19124986
ARNT2 [Q86TN1]3EBI-10975473,EBI-25844820
ASB3 - isoform 3 [Q9Y575-3]3EBI-10975473,EBI-14199987
ASB9 [Q96DX5]3EBI-10975473,EBI-745641
ASB9 - isoform 3 [Q96DX5-3]3EBI-10975473,EBI-25843552
ASCL4 [Q6XD76]3EBI-10975473,EBI-10254793
ASIC4 - isoform 3 [Q96FT7-4]3EBI-10975473,EBI-9089489
ATG10 [Q9H0Y0]3EBI-10975473,EBI-1048913
ATP6V1B1 [P15313]3EBI-10975473,EBI-2891281
BAG6 - isoform 2 [P46379-2]3EBI-10975473,EBI-10988864
BAIAP2 - isoform 6 [Q9UQB8-6]3EBI-10975473,EBI-9092016
BAK1 [Q16611]3EBI-10975473,EBI-519866
BAP18 [Q8IXM2]3EBI-10975473,EBI-4280811
BATF [Q16520]3EBI-10975473,EBI-749503
BCL2L13 [Q9BXK5]3EBI-10975473,EBI-747430
BECN1 [Q14457]3EBI-10975473,EBI-949378
BMF [Q96LC9]3EBI-10975473,EBI-3919268
BRK1 [Q8WUW1]3EBI-10975473,EBI-2837444
BRWD1 - isoform D [Q9NSI6-4]3EBI-10975473,EBI-10693038
C11orf54 - isoform 4 [Q9H0W9-4]3EBI-10975473,EBI-25849710
C12orf74 [Q32Q52]3EBI-10975473,EBI-12891828
C19orf57 [Q0VDD7]3EBI-10975473,EBI-741210
C1orf216 [Q8TAB5]3EBI-10975473,EBI-747505
C7orf31 [Q8N865]3EBI-10975473,EBI-10174456
C8orf48 [Q96LL4]3EBI-10975473,EBI-751596
CAMK1G [Q96NX5]3EBI-10975473,EBI-3920838
CAMKK1 - isoform 2 [Q8N5S9-2]3EBI-10975473,EBI-25850646
CCDC141 [Q6ZP82]3EBI-10975473,EBI-928795
CCDC17 - isoform 2 [Q96LX7-5]3EBI-10975473,EBI-12165781
CCDC196 [A0A1B0GWI1]3EBI-10975473,EBI-10181422
CCDC9 [Q9Y3X0]3EBI-10975473,EBI-2557532
CDC23 [Q9UJX2]3EBI-10975473,EBI-396137
CFAP100 - isoform 2 [Q494V2-2]3EBI-10975473,EBI-11953200
CIAO2B [Q9Y3D0]3EBI-10975473,EBI-744045
CLINT1 [Q14677]3EBI-10975473,EBI-1171113
CLIP3 [Q96DZ5]3EBI-10975473,EBI-12823145
CNST - isoform 3 [Q6PJW8-3]3EBI-10975473,EBI-25836090
COG8 [Q96MW5]3EBI-10975473,EBI-720875
CRLF3 [Q8IUI8]3EBI-10975473,EBI-2872414
CRYAA2 [A0A140G945]3EBI-10975473,EBI-25838900
CXorf38 [Q8TB03]3EBI-10975473,EBI-12024320
CYB5A [P00167]3EBI-10975473,EBI-1047284
CYFIP1 [Q7L576]3EBI-10975473,EBI-1048143
DCAF8 - isoform 2 [Q5TAQ9-2]3EBI-10975473,EBI-25842815
DKFZp547K2416 [Q8NDP9]3EBI-10975473,EBI-25842538
DLGAP2 - isoform 3 [Q9P1A6-3]3EBI-10975473,EBI-12019838
DMRTA1 [Q5VZB9]3EBI-10975473,EBI-3939812
DOK3 - isoform 3 [Q7L591-3]3EBI-10975473,EBI-10694655
DOM3Z [A0A024RCP2]3EBI-10975473,EBI-25847826
DPYSL4 [O14531]3EBI-10975473,EBI-719542
DPYSL5 [Q9BPU6]3EBI-10975473,EBI-724653
DVL3 [Q92997]3EBI-10975473,EBI-739789
EED - isoform 2 [O75530-2]3EBI-10975473,EBI-11132357
EIF3F [O00303]3EBI-10975473,EBI-711990
EPS8L2 [Q9H6S3]3EBI-10975473,EBI-3940939
ERCC8 - isoform 2 [Q13216-2]3EBI-10975473,EBI-16466949
ESM1 [Q9NQ30]3EBI-10975473,EBI-12260294
ESRP1 [Q6NXG1]3EBI-10975473,EBI-10213520
EYA3 [Q99504]3EBI-10975473,EBI-9089567
FABP7 [O15540]3EBI-10975473,EBI-10697159
FAM117B [Q6P1L5]3EBI-10975473,EBI-3893327
FAM135B - isoform 4 [Q49AJ0-4]3EBI-10975473,EBI-25835236
FAM163A [Q96GL9]3EBI-10975473,EBI-11793142
FAM98C [Q17RN3]3EBI-10975473,EBI-5461838
FAM9A [Q8IZU1]3EBI-10975473,EBI-8468186
FANCG [O15287]3EBI-10975473,EBI-81610
FANK1 [Q8TC84]3EBI-10975473,EBI-21975404
FASTKD1 [Q53R41]3EBI-10975473,EBI-3957005
FBP2 [O00757]3EBI-10975473,EBI-719781
FEZ2 [Q9UHY8]3EBI-10975473,EBI-396453
FOSL1 [P15407]3EBI-10975473,EBI-744510
GALNT6 [Q8NCL4]3EBI-10975473,EBI-3907241
GATA1 - isoform 2 [P15976-2]3EBI-10975473,EBI-9090198
GFOD1 [Q9NXC2]3EBI-10975473,EBI-8799578
GLI4 [P10075]3EBI-10975473,EBI-14061927
GOLGA2P5 [Q9HBQ8]3EBI-10975473,EBI-22000587
GPANK1 [O95872]3EBI-10975473,EBI-751540
GPR141 [Q7Z602]3EBI-10975473,EBI-21649723
GPSM3 [Q9Y4H4]3EBI-10975473,EBI-347538
H3-5 [Q6NXT2]3EBI-10975473,EBI-2868501
hCG_2001421 [A8K0U2]3EBI-10975473,EBI-25843825
hCG_41307 [A0A024R1L7]3EBI-10975473,EBI-25849938
HOXA1 [P49639]3EBI-10975473,EBI-740785
HOXC4 [P09017]3EBI-10975473,EBI-3923226
HSPBAP1 - isoform 2 [Q96EW2-2]3EBI-10975473,EBI-25835621
IFT20 - isoform 3 [Q8IY31-3]3EBI-10975473,EBI-9091197
IGFBP4 [P22692]3EBI-10975473,EBI-2831948
IL16 - isoform 2 [Q14005-2]3EBI-10975473,EBI-17178971
ILF3 [Q9NXX0]3EBI-10975473,EBI-743980
ING5 - isoform 2 [Q8WYH8-2]3EBI-10975473,EBI-21602071
IQCF2 [Q8IXL9]3EBI-10975473,EBI-10238842
IQUB [Q8NA54]3EBI-10975473,EBI-10220600
ISCA2 [Q86U28]3EBI-10975473,EBI-10258659
ITGB1BP2 - isoform 2 [Q9UKP3-2]3EBI-10975473,EBI-25856470
JMJD7 [P0C870]3EBI-10975473,EBI-9090173
KBTBD4 - isoform 2 [Q9NVX7-2]3EBI-10975473,EBI-25871195
KCTD13 [Q8WZ19]3EBI-10975473,EBI-742916
KCTD15 - isoform 2 [Q96SI1-2]3EBI-10975473,EBI-12382297
KDSR [Q06136]3EBI-10975473,EBI-3909166
KIAA0408 [Q6ZU52]3EBI-10975473,EBI-739493
KIF1A [Q12756]3EBI-10975473,EBI-2679809
KLF15 [Q9UIH9]3EBI-10975473,EBI-2796400
KLF3 [P57682]3EBI-10975473,EBI-8472267
KLHL20 [Q9Y2M5]3EBI-10975473,EBI-714379
KRT222 [Q8N1A0]3EBI-10975473,EBI-8473062
KRT33B [Q14525]3EBI-10975473,EBI-1049638
KRTAP13-3 [Q3SY46]3EBI-10975473,EBI-10241252
KRTAP19-7 [Q3SYF9]3EBI-10975473,EBI-10241353
KRTAP8-1 [Q8IUC2]3EBI-10975473,EBI-10261141
LASP1 - isoform 2 [Q14847-2]3EBI-10975473,EBI-9088686
LCA5L [O95447]3EBI-10975473,EBI-8473670
LCE1B [Q5T7P3]3EBI-10975473,EBI-10245913
LENG8 [Q96PV6]3EBI-10975473,EBI-739546
LHX8 [Q68G74]3EBI-10975473,EBI-8474075
LNX2 [Q8N448]3EBI-10975473,EBI-2340947
LOC401296 [A2RU56]3EBI-10975473,EBI-9088215
LOXL4 [Q96JB6]3EBI-10975473,EBI-749562
LPIN1 [Q14693]3EBI-10975473,EBI-5278370
MALT1 - isoform 2 [Q9UDY8-2]3EBI-10975473,EBI-12056869
MAP3K5 [Q99683]3EBI-10975473,EBI-476263
MAX - isoform 4 [P61244-4]3EBI-10975473,EBI-25848049
MBIP - isoform 4 [Q9NS73-5]3EBI-10975473,EBI-10182361
MECOM - isoform 9 [Q03112-9]3EBI-10975473,EBI-23820194
METTL27 [Q8N6F8]3EBI-10975473,EBI-8487781
MIS18A [Q9NYP9]3EBI-10975473,EBI-1104552
MLC1 [Q15049]3EBI-10975473,EBI-8475277
MLST8 [A0A0A0MR05]3EBI-10975473,EBI-25835557
MPND [Q8N594]3EBI-10975473,EBI-2512452
MRFAP1 [Q9Y605]3EBI-10975473,EBI-995714
MRFAP1L1 [Q96HT8]3EBI-10975473,EBI-748896
MSRB3 - isoform 2 [Q8IXL7-2]3EBI-10975473,EBI-10699187
MYNN [Q9NPC7]3EBI-10975473,EBI-3446748
NDUFS1 - isoform 5 [P28331-5]3EBI-10975473,EBI-25876328
NEBL [O76041]3EBI-10975473,EBI-2880203
NEFL [I6L9F6]3EBI-10975473,EBI-10178578
NGEF [Q8N5V2]3EBI-10975473,EBI-718372
NHLRC2 - isoform 2 [Q8NBF2-2]3EBI-10975473,EBI-10697320
NR1D2 [Q14995]3EBI-10975473,EBI-6144053
NSMCE2 [Q96MF7]3EBI-10975473,EBI-2557388
NSMF - isoform 6 [Q6X4W1-6]3EBI-10975473,EBI-25842707
NUDT1 - isoform p18 [P36639-4]3EBI-10975473,EBI-25834643
NUFIP2 [Q7Z417]3EBI-10975473,EBI-1210753
NVL - isoform 5 [O15381-5]3EBI-10975473,EBI-18577082
ODF2 - isoform 2 [Q5BJF6-2]3EBI-10975473,EBI-9090919
OIP5 [O43482]3EBI-10975473,EBI-536879
OTUB1 [Q96FW1]3EBI-10975473,EBI-1058491
OTUD7B - isoform 2 [Q6GQQ9-2]3EBI-10975473,EBI-25830200
PARP11 - isoform 4 [Q9NR21-5]3EBI-10975473,EBI-17159452
PATZ1 - isoform 4 [Q9HBE1-4]3EBI-10975473,EBI-11022007
PCMT1 - isoform 2 [P22061-2]3EBI-10975473,EBI-12386584
PCMTD2 [Q9NV79]3EBI-10975473,EBI-6309018
PELO [Q9BRX2]3EBI-10975473,EBI-1043580
PER1 [O15534]3EBI-10975473,EBI-2557276
PERP [Q96FX8]3EBI-10975473,EBI-17183069
PGLYRP3 [Q96LB9]3EBI-10975473,EBI-12339509
PHF5A [Q7RTV0]3EBI-10975473,EBI-2555365
PIAS1 [O75925]3EBI-10975473,EBI-629434
PLEKHB1 - isoform 2 [Q9UF11-2]3EBI-10975473,EBI-12832742
PLEKHG4 - isoform 2 [Q58EX7-2]3EBI-10975473,EBI-21503705
PLIN2 [Q99541]3EBI-10975473,EBI-2115275
PLPPR1 [Q8TBJ4]3EBI-10975473,EBI-18063495
POC5 - isoform 3 [Q8NA72-3]3EBI-10975473,EBI-11751537
POLR3F [Q9H1D9]3EBI-10975473,EBI-710067
PRKAB2 [O43741]3EBI-10975473,EBI-1053424
PRPS1 [P60891]3EBI-10975473,EBI-749195
PRPS2 [P11908]3EBI-10975473,EBI-4290895
PSMB8 - isoform 2 [P28062-2]3EBI-10975473,EBI-372312
QARS1 [P47897]3EBI-10975473,EBI-347462
RAI2 [Q9Y5P3]3EBI-10975473,EBI-746228
RBM14 [Q96PK6]3EBI-10975473,EBI-954272
RCOR3 - isoform 2 [Q9P2K3-2]3EBI-10975473,EBI-1504830
RHBDD2 - isoform 3 [Q6NTF9-3]3EBI-10975473,EBI-17589229
RNASEH2C [Q8TDP1]3EBI-10975473,EBI-9027335
RNF10 [Q8N5U6]3EBI-10975473,EBI-714023
RNF138 [Q8WVD3]3EBI-10975473,EBI-749039
RNF183 [Q96D59]3EBI-10975473,EBI-743938
RNF208 [Q9H0X6]3EBI-10975473,EBI-751555
RPS15A [P62244]3EBI-10975473,EBI-347895
RPSA [P08865]3EBI-10975473,EBI-354112
RUSC1-AS1 [Q66K80]3EBI-10975473,EBI-10248967
RYBP [Q8N488]3EBI-10975473,EBI-752324
SAMD3 - isoform 2 [Q8N6K7-2]3EBI-10975473,EBI-11528848
SAMD7 [Q7Z3H4]3EBI-10975473,EBI-12148649
SDC2 [P34741]3EBI-10975473,EBI-1172957
SDCBP [O00560]3EBI-10975473,EBI-727004
SEMA4G - isoform 3 [Q9NTN9-3]3EBI-10975473,EBI-9089805
SH3KBP1 [Q96B97]3EBI-10975473,EBI-346595
SHFL - isoform 3 [Q9NUL5-3]3EBI-10975473,EBI-22000547
SHLD1 [Q8IYI0]3EBI-10975473,EBI-2560428
SHOX2 - isoform 3 [O60902-3]3EBI-10975473,EBI-9092164
SKIL [P12757]3EBI-10975473,EBI-2902468
SLC3A2 - isoform 4 [P08195-4]3EBI-10975473,EBI-12832276
SLC6A13 - isoform 3 [Q9NSD5-3]3EBI-10975473,EBI-25831241
SNAPC3 [Q92966]3EBI-10975473,EBI-1760638
SNW1 [Q13573]3EBI-10975473,EBI-632715
SPAG8 - isoform 2 [Q99932-2]3EBI-10975473,EBI-11959123
SPATA3 [A0A024R4B0]3EBI-10975473,EBI-14123856
SPPL2B - isoform 2 [Q8TCT7-2]3EBI-10975473,EBI-8345366
SPRED2 [Q7Z698]3EBI-10975473,EBI-7082156
SPRY4 [Q9C004]3EBI-10975473,EBI-354861
SPSB2 [Q99619]3EBI-10975473,EBI-2323209
SRGAP3 [Q8IXS7]3EBI-10975473,EBI-18616594
STAM2 [O75886]3EBI-10975473,EBI-373258
SUMF2 [Q8NBJ7]3EBI-10975473,EBI-723091
SYNC [Q9H7C4]3EBI-10975473,EBI-11285923
SYT16 - isoform 3 [Q17RD7-3]3EBI-10975473,EBI-25861603
TADA2B - isoform 3 [Q86TJ2-3]3EBI-10975473,EBI-18173581
TASOR2 [Q5VWN6]3EBI-10975473,EBI-745958
TCEAL8 [Q8IYN2]3EBI-10975473,EBI-2116184
TCF25 [Q9BQ70]3EBI-10975473,EBI-745182
TDG [Q13569]3EBI-10975473,EBI-348333
TEN1 [Q86WV5]3EBI-10975473,EBI-2562799
TENT5B [Q96A09]3EBI-10975473,EBI-752030
TEX19 [Q8NA77]3EBI-10975473,EBI-13323487
TGM2 - isoform 2 [P21980-2]3EBI-10975473,EBI-25842075
TIMM17B [O60830]3EBI-10975473,EBI-2372529
TMEM61 [Q8N0U2]3EBI-10975473,EBI-25830583
TMTC1 - isoform 4 [Q8IUR5-4]3EBI-10975473,EBI-9089156
TMUB2 - isoform 4 [Q71RG4-4]3EBI-10975473,EBI-25831574
TRIM23 [P36406]3EBI-10975473,EBI-740098
TRIM35 - isoform 2 [Q9UPQ4-2]3EBI-10975473,EBI-17716262
TRIM65 [L8E9Q5]3EBI-10975473,EBI-25843781
TRIM69 - isoform 2 [Q86WT6-2]3EBI-10975473,EBI-11525489
TRIM9 [Q9C026]3EBI-10975473,EBI-720828
TSC1 [Q86WV8]3EBI-10975473,EBI-12806590
TSC22D4 [Q9Y3Q8]3EBI-10975473,EBI-739485
TUBB6 [Q9BUF5]3EBI-10975473,EBI-356735
TUBGCP4 - isoform 2 [Q9UGJ1-2]3EBI-10975473,EBI-10964469
TUT7 - isoform 5 [Q5VYS8-5]3EBI-10975473,EBI-9088812
UBAC1 [Q9BSL1]3EBI-10975473,EBI-749370
UBAC2 - isoform 4 [Q8NBM4-4]3EBI-10975473,EBI-25840976
UBE2E3 [Q969T4]3EBI-10975473,EBI-348496
UBE2V1 [Q13404]3EBI-10975473,EBI-1050671
UBXN1 - isoform 2 [Q04323-2]3EBI-10975473,EBI-11530712
USP2 - isoform 3 [O75604-3]3EBI-10975473,EBI-10696113
VDAC2 [P45880]3EBI-10975473,EBI-354022
VHL - isoform 2 [P40337-2]3EBI-10975473,EBI-12157263
VPS37A [Q8NEZ2]3EBI-10975473,EBI-2850578
VSX2 [P58304]3EBI-10975473,EBI-6427899
WDR77 [Q9BQA1]3EBI-10975473,EBI-1237307
WDR83 [Q9BRX9]3EBI-10975473,EBI-7705033
WTAP - isoform 2 [Q15007-2]3EBI-10975473,EBI-25840023
WWOX - isoform 5 [Q9NZC7-5]3EBI-10975473,EBI-12040603
ZBTB24 - isoform 2 [O43167-2]3EBI-10975473,EBI-25842419
ZC2HC1C - isoform 2 [Q53FD0-2]3EBI-10975473,EBI-14104088
ZKSCAN8 [Q15776]3EBI-10975473,EBI-2602314
ZNF180 - isoform 4 [Q9UJW8-4]3EBI-10975473,EBI-12055755
ZNF366 [Q8N895]3EBI-10975473,EBI-2813661
ZNF436 [Q9C0F3]3EBI-10975473,EBI-8489702
ZNF444 - isoform 2 [Q8N0Y2-2]3EBI-10975473,EBI-12010736
ZNF488 - isoform 2 [Q96MN9-2]3EBI-10975473,EBI-25831733
ZNF497 [Q6ZNH5]3EBI-10975473,EBI-10486136
ZNF524 [Q96C55]3EBI-10975473,EBI-10283126
ZNF57 [Q68EA5]3EBI-10975473,EBI-8490788
ZNF572 [Q7Z3I7]3EBI-10975473,EBI-10172590
ZNF641 - isoform 2 [Q96N77-2]3EBI-10975473,EBI-12939666
ZNF670 [Q9BS34]3EBI-10975473,EBI-745276
ZNF829 - isoform 3 [Q3KNS6-3]3EBI-10975473,EBI-18036029
ZRSR2P1 [Q15695]3EBI-10975473,EBI-12270264
ZSCAN9 [O15535]3EBI-10975473,EBI-751531
ZXDC [Q2QGD7]3EBI-10975473,EBI-1538838
A0A384ME253EBI-10975473,EBI-10211777
B4DLR93EBI-10975473,EBI-25851268
B7Z3E83EBI-10975473,EBI-25831617
Q7L8T73EBI-10975473,EBI-25831943
Q7Z7833EBI-10975473,EBI-9088990
Q86V283EBI-10975473,EBI-10259496
Isoform 3 [O60333-3]
With#Exp.IntAct
DLG1 [Q12959]4EBI-465669,EBI-357481
DLG4 [P78352]4EBI-465669,EBI-80389
MAGI1 [Q96QZ7]3EBI-465669,EBI-924464
Dlg2 [Q63622] from Rattus norvegicus.3EBI-465669,EBI-396947

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116723, 72 interactors

Database of interacting proteins

More...
DIPi
DIP-33015N

Protein interaction database and analysis system

More...
IntActi
O60333, 336 interactors

Molecular INTeraction database

More...
MINTi
O60333

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000263934

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O60333

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O60333, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11816
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O60333

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O60333

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 354Kinesin motorPROSITE-ProRule annotationAdd BLAST350
Domaini556 – 612FHAPROSITE-ProRule annotationAdd BLAST57
Domaini1702 – 1799PHPROSITE-ProRule annotationAdd BLAST98

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni270 – 350Interaction with KBP1 PublicationAdd BLAST81

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili365 – 386Sequence analysisAdd BLAST22
Coiled coili470 – 502Sequence analysisAdd BLAST33
Coiled coili668 – 737Sequence analysisAdd BLAST70
Coiled coili841 – 869Sequence analysisAdd BLAST29

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family. Unc-104 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0245, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157445

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009645_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O60333

Identification of Orthologs from Complete Genome Data

More...
OMAi
LHQEDEF

Database of Orthologous Groups

More...
OrthoDBi
76316at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O60333

TreeFam database of animal gene trees

More...
TreeFami
TF105221

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060, FHA, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.40.850.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000253, FHA_dom
IPR022164, Kinesin-like
IPR027640, Kinesin-like_fam
IPR022140, Kinesin-like_KIF1-typ
IPR032405, Kinesin_assoc
IPR019821, Kinesin_motor_CS
IPR001752, Kinesin_motor_dom
IPR036961, Kinesin_motor_dom_sf
IPR027417, P-loop_NTPase
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR008984, SMAD_FHA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24115, PTHR24115, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12473, DUF3694, 1 hit
PF00498, FHA, 1 hit
PF12423, KIF1B, 1 hit
PF00225, Kinesin, 1 hit
PF16183, Kinesin_assoc, 1 hit
PF00169, PH, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00380, KINESINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240, FHA, 1 hit
SM00129, KISc, 1 hit
SM00233, PH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879, SSF49879, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50006, FHA_DOMAIN, 1 hit
PS00411, KINESIN_MOTOR_1, 1 hit
PS50067, KINESIN_MOTOR_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O60333-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGASVKVAV RVRPFNSRET SKESKCIIQM QGNSTSIINP KNPKEAPKSF
60 70 80 90 100
SFDYSYWSHT SPEDPCFASQ NRVYNDIGKE MLLHAFEGYN VCIFAYGQTG
110 120 130 140 150
AGKSYTMMGK QEESQAGIIP QLCEELFEKI NDNCNEEMSY SVEVSYMEIY
160 170 180 190 200
CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYT DIADLMDAGN
210 220 230 240 250
KARTVAATNM NETSSRSHAV FTIVFTQKKH DNETNLSTEK VSKISLVDLA
260 270 280 290 300
GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEVDN CTSKSKKKKK
310 320 330 340 350
TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR
360 370 380 390 400
AKQIKCNAVI NEDPNAKLVR ELKEEVTRLK DLLRAQGLGD IIDIDPLIDD
410 420 430 440 450
YSGSGSKYLK DFQNNKHRYL LASENQRPGH FSTASMGSLT SSPSSCSLSS
460 470 480 490 500
QVGLTSVTSI QERIMSTPGG EEAIERLKES EKIIAELNET WEEKLRKTEA
510 520 530 540 550
IRMEREALLA EMGVAIREDG GTLGVFSPKK TPHLVNLNED PLMSECLLYY
560 570 580 590 600
IKDGITRVGQ ADAERRQDIV LSGAHIKEEH CIFRSERSNS GEVIVTLEPC
610 620 630 640 650
ERSETYVNGK RVSQPVQLRS GNRIIMGKNH VFRFNHPEQA RAEREKTPSA
660 670 680 690 700
ETPSEPVDWT FAQRELLEKQ GIDMKQEMEK RLQEMEILYK KEKEEADLLL
710 720 730 740 750
EQQRLDYESK LQALQKQVET RSLAAETTEE EEEEEEVPWT QHEFELAQWA
760 770 780 790 800
FRKWKSHQFT SLRDLLWGNA VYLKEANAIS VELKKKVQFQ FVLLTDTLYS
810 820 830 840 850
PLPPELLPTE MEKTHEDRPF PRTVVAVEVQ DLKNGATHYW SLEKLKQRLD
860 870 880 890 900
LMREMYDRAG EMASSAQDES ETTVTGSDPF YDRFHWFKLV GSSPIFHGCV
910 920 930 940 950
NERLADRTPS PTFSTADSDI TELADEQQDE MEDFDDEAFV DDAGSDAGTE
960 970 980 990 1000
EGSDLFSDGH DPFYDRSPWF ILVGRAFVYL SNLLYPVPLI HRVAIVSEKG
1010 1020 1030 1040 1050
EVRGFLRVAV QAIAADEEAP DYGSGIRQSG TAKISFDNEY FNQSDFSSVA
1060 1070 1080 1090 1100
MTRSGLSLEE LRIVEGQGQS SEVITPPEEI SRINDLDLKS STLLDGKMVM
1110 1120 1130 1140 1150
EGFSEEIGNH LKLGSAFTFR VTVLQASGIL PEYADIFCQF NFLHRHDEAF
1160 1170 1180 1190 1200
STEPLKNNGR GSPLAFYHVQ NIAVEITESF VDYIKTKPIV FEVFGHYQQH
1210 1220 1230 1240 1250
PLHLQGQELN SPPQPCRRFF PPPMPLSKPV PATKLNTMSK TSLGQSMSKY
1260 1270 1280 1290 1300
DLLVWFEISE LEPTGEYIPA VVDHTAGLPC QGTFLLHQGI QRRITVTIIH
1310 1320 1330 1340 1350
EKGSELHWKD VRELVVGRIR NKPEVDEAAV DAILSLNIIS AKYLKSSHNS
1360 1370 1380 1390 1400
SRTFYRFEAV WDSSLHNSLL LNRVTPYGEK IYMTLSAYLE LDHCIQPAVI
1410 1420 1430 1440 1450
TKDVCMVFYS RDAKISPPRS LRSLFGSGYS KSPDSNRVTG IYELSLCKMS
1460 1470 1480 1490 1500
DTGSPGMQRR RRKILDTSVA YVRGEENLAG WRPRGDSLIL EHQWELEKLE
1510 1520 1530 1540 1550
LLHEVEKTRH FLLLRERLGD SIPKSLSDSL SPSLSSGTLS TSTSISSQIS
1560 1570 1580 1590 1600
TTTFESAITP SESSGYDSGD IESLVDREKE LATKCLQLLT HTFNREFSQV
1610 1620 1630 1640 1650
HGSVSDCKLS DISPIGRDPS ESSFSSATLT PSSTCPSLVD SRSNSLDQKT
1660 1670 1680 1690 1700
PEANSRASSP CPEFEQFQIV PAVETPYLAR AGKNEFLNLV PDIEEIRPSS
1710 1720 1730 1740 1750
VVSKKGYLHF KEPLYSNWAK HFVVVRRPYV FIYNSDKDPV ERGIINLSTA
1760 1770 1780 1790 1800
QVEYSEDQQA MVKTPNTFAV CTKHRGVLLQ ALNDKDMNDW LYAFNPLLAG
1810
TIRSKLSRRC PSQSKY
Length:1,816
Mass (Da):204,476
Last modified:October 17, 2006 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAD62F0515978C783
GO
Isoform 2 (identifier: O60333-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T

Show »
Length:1,770
Mass (Da):199,263
Checksum:i8AE6BB2665AF702C
GO
Isoform 3 (identifier: O60333-3) [UniParc]FASTAAdd to basket
Also known as: Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     289-294: Missing.
     394-434: IDPLIDDYSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTA → T
     707-1196: YESKLQALQK...KPIVFEVFGH → ADSDSGDDSD...NLKAGRETTV
     1197-1816: Missing.

Show »
Length:1,153
Mass (Da):130,363
Checksum:i6F0D8846CD283811
GO
Isoform 4 (identifier: O60333-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1804-1816: SKLSRRCPSQSKY → PGHLASEIIREDKSVSFSCQ

Show »
Length:1,823
Mass (Da):205,140
Checksum:iA53CAAD5693880E7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q4R9M9Q4R9M9_HUMAN
Kinesin family member 1Bbeta isofor...
KIF1B KIF1Bbeta
1,809Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWA3A0A087WWA3_HUMAN
Kinesin-like protein KIF1B
KIF1B
1,797Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQL3A0A0U1RQL3_HUMAN
Kinesin-like protein KIF1B
KIF1B
498Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH01415 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAP35838 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAA25517 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAA95972 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAB69038 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti87E → G in BAA25517 (PubMed:10819331).Curated1
Sequence conflicti129 – 131KIN → TNH in AAK49332 (PubMed:11526494).Curated3
Sequence conflicti129 – 131KIN → TNH in AAK85155 (Ref. 4) Curated3
Sequence conflicti129 – 131KIN → TNH in AAN17742 (Ref. 5) Curated3
Sequence conflicti170E → D in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti170E → D in AAK85155 (Ref. 4) Curated1
Sequence conflicti170E → D in AAN17742 (Ref. 5) Curated1
Sequence conflicti174L → R in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti174L → R in AAK85155 (Ref. 4) Curated1
Sequence conflicti174L → R in AAN17742 (Ref. 5) Curated1
Sequence conflicti219 – 221AVF → VVY in AAK49332 (PubMed:11526494).Curated3
Sequence conflicti219 – 221AVF → VVY in AAK85155 (Ref. 4) Curated3
Sequence conflicti219 – 221AVF → VVY in AAN17742 (Ref. 5) Curated3
Sequence conflicti235 – 239NLSTE → ILATV in AAK49332 (PubMed:11526494).Curated5
Sequence conflicti235 – 239NLSTE → ILATV in AAK85155 (Ref. 4) Curated5
Sequence conflicti235 – 239NLSTE → ILATV in AAN17742 (Ref. 5) Curated5
Sequence conflicti244I → T in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti244I → T in AAK85155 (Ref. 4) Curated1
Sequence conflicti244I → T in AAN17742 (Ref. 5) Curated1
Sequence conflicti253E → D in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti253E → D in AAK85155 (Ref. 4) Curated1
Sequence conflicti253E → D in AAN17742 (Ref. 5) Curated1
Sequence conflicti256D → A in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti256D → A in AAK85155 (Ref. 4) Curated1
Sequence conflicti256D → A in AAN17742 (Ref. 5) Curated1
Sequence conflicti270N → I in AAK49332 (PubMed:11526494).Curated1
Sequence conflicti270N → I in AAK85155 (Ref. 4) Curated1
Sequence conflicti270N → I in AAN17742 (Ref. 5) Curated1
Sequence conflicti363D → G in BAB69038 (PubMed:10762626).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06353134S → L in a medulloblastoma sample; somatic mutation; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant dbSNP:rs1269940164Ensembl.1
Natural variantiVAR_01151598Q → L in CMT2A1. 1 PublicationCorresponds to variant dbSNP:rs121908160EnsemblClinVar.1
Natural variantiVAR_063532692E → V Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant dbSNP:rs121908161Ensembl.1
Natural variantiVAR_063533873T → I Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant dbSNP:rs121908162Ensembl.1
Natural variantiVAR_0635341133Y → C1 PublicationCorresponds to variant dbSNP:rs2297881Ensembl.1
Natural variantiVAR_0635351263P → S Confers susceptibility to neuroblastoma; found as germline mutation in a neuroblastoma patient; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant dbSNP:rs121908163Ensembl.1
Natural variantiVAR_0635361527S → N Confers susceptibility to pheochromocytoma; found as germline mutation in a pheochromocytoma family; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant dbSNP:rs121908164Ensembl.1
Natural variantiVAR_0635371600V → M1 PublicationCorresponds to variant dbSNP:rs77172218Ensembl.1
Natural variantiVAR_0635381674E → K in a pheochromocytoma sample; loss of ability to induce apoptosis. 1 PublicationCorresponds to variant dbSNP:rs143669846Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002858289 – 294Missing in isoform 2 and isoform 3. 4 Publications6
Alternative sequenceiVSP_002859394 – 434IDPLI…HFSTA → T in isoform 2 and isoform 3. 4 PublicationsAdd BLAST41
Alternative sequenceiVSP_002860707 – 1196YESKL…EVFGH → ADSDSGDDSDKRSCEESWKL ITSLREKLPPSKLQTIVKKC GLPSSGKKREPIKMYQIPQR RRLSKDSKWVTISDLKIQAV KEICYEVALNDFRHSRQEIE ALAIVKMKELCAMYGKKDPN ERDSWRAVARDVWDTVGVGD EKIEDVMATGKGSTDVDDLK VHIDKLEDILQEVKKQNNMK DEEIKVLRNKMLKMEKVLPL IGSQEQKSPGSHKAKEPVGA GVSSTSENNVSKGDNGELAK EERVSQLMNGDPAFRRGRLR WMRQEQIRFKNLQQQEITKQ LRRQNVPHRFIPPENRKPRF PFKSNPKHRNSWSPGTHIII TEDEVIELRIPKDDEARKGN KEESQEKGGKGAFKDPQFPW GSQGMRSQDHIQVSKQHINN QQQPPQLRWRSNSLNNGQPK STRCQASASAESLNSHSGHP TADVQTFQAKRHIHQHRQSY CNYNTGGQLEGNAATSYQKQ TDKPSHCSQFVTPPRMRRQF SAPNLKAGRETTV in isoform 3. 4 PublicationsAdd BLAST490
Alternative sequenceiVSP_0028611197 – 1816Missing in isoform 3. 4 PublicationsAdd BLAST620
Alternative sequenceiVSP_0093811804 – 1816SKLSR…SQSKY → PGHLASEIIREDKSVSFSCQ in isoform 4. 2 PublicationsAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AX039604 Genomic DNA Translation: CAC16629.1
AB017133 mRNA Translation: BAB69038.1 Different initiation.
AF257176 mRNA Translation: AAK49332.1
AY043362 mRNA Translation: AAK85155.1
AB088210 mRNA Translation: BAE02543.1
AY139835 mRNA Translation: AAN17742.1
AB011163 mRNA Translation: BAA25517.2 Different initiation.
AB040881 mRNA Translation: BAA95972.2 Different initiation.
AL139424 Genomic DNA No translation available.
AL358013 Genomic DNA No translation available.
BC001415 mRNA Translation: AAH01415.1 Different initiation.
BC115395 mRNA Translation: AAI15396.1
BT007174 mRNA Translation: AAP35838.1 Different initiation.
AK022977 mRNA Translation: BAB14341.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS111.1 [O60333-2]
CCDS112.1 [O60333-3]

NCBI Reference Sequences

More...
RefSeqi
NP_055889.2, NM_015074.3 [O60333-2]
NP_904325.2, NM_183416.3 [O60333-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263934; ENSP00000263934; ENSG00000054523 [O60333-2]
ENST00000377081; ENSP00000366284; ENSG00000054523 [O60333-4]
ENST00000377083; ENSP00000366287; ENSG00000054523 [O60333-3]
ENST00000377086; ENSP00000366290; ENSG00000054523 [O60333-1]
ENST00000377093; ENSP00000366297; ENSG00000054523 [O60333-3]
ENST00000676179; ENSP00000502065; ENSG00000054523 [O60333-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23095

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23095

UCSC genome browser

More...
UCSCi
uc001aqv.5, human [O60333-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Inherited peripheral neuropathies mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AX039604 Genomic DNA Translation: CAC16629.1
AB017133 mRNA Translation: BAB69038.1 Different initiation.
AF257176 mRNA Translation: AAK49332.1
AY043362 mRNA Translation: AAK85155.1
AB088210 mRNA Translation: BAE02543.1
AY139835 mRNA Translation: AAN17742.1
AB011163 mRNA Translation: BAA25517.2 Different initiation.
AB040881 mRNA Translation: BAA95972.2 Different initiation.
AL139424 Genomic DNA No translation available.
AL358013 Genomic DNA No translation available.
BC001415 mRNA Translation: AAH01415.1 Different initiation.
BC115395 mRNA Translation: AAI15396.1
BT007174 mRNA Translation: AAP35838.1 Different initiation.
AK022977 mRNA Translation: BAB14341.1
CCDSiCCDS111.1 [O60333-2]
CCDS112.1 [O60333-3]
RefSeqiNP_055889.2, NM_015074.3 [O60333-2]
NP_904325.2, NM_183416.3 [O60333-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EH0NMR-A531-647[»]
SMRiO60333
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116723, 72 interactors
DIPiDIP-33015N
IntActiO60333, 336 interactors
MINTiO60333
STRINGi9606.ENSP00000263934

Chemistry databases

BindingDBiO60333
ChEMBLiCHEMBL5889

PTM databases

iPTMnetiO60333
MetOSiteiO60333
PhosphoSitePlusiO60333
SwissPalmiO60333

Genetic variation databases

BioMutaiKIF1B

Proteomic databases

EPDiO60333
jPOSTiO60333
MassIVEiO60333
MaxQBiO60333
PaxDbiO60333
PeptideAtlasiO60333
PRIDEiO60333
ProteomicsDBi49353 [O60333-1]
49354 [O60333-2]
49355 [O60333-3]
49356 [O60333-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
4196, 104 antibodies

The DNASU plasmid repository

More...
DNASUi
23095

Genome annotation databases

EnsembliENST00000263934; ENSP00000263934; ENSG00000054523 [O60333-2]
ENST00000377081; ENSP00000366284; ENSG00000054523 [O60333-4]
ENST00000377083; ENSP00000366287; ENSG00000054523 [O60333-3]
ENST00000377086; ENSP00000366290; ENSG00000054523 [O60333-1]
ENST00000377093; ENSP00000366297; ENSG00000054523 [O60333-3]
ENST00000676179; ENSP00000502065; ENSG00000054523 [O60333-1]
GeneIDi23095
KEGGihsa:23095
UCSCiuc001aqv.5, human [O60333-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23095
DisGeNETi23095

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KIF1B
GeneReviewsiKIF1B
HGNCiHGNC:16636, KIF1B
HPAiENSG00000054523, Tissue enhanced (skeletal)
MalaCardsiKIF1B
MIMi118210, phenotype
171300, phenotype
256700, phenotype
605995, gene
neXtProtiNX_O60333
OpenTargetsiENSG00000054523
Orphaneti99946, Autosomal dominant Charcot-Marie-Tooth disease type 2A1
29072, Hereditary pheochromocytoma-paraganglioma
PharmGKBiPA38176
VEuPathDBiHostDB:ENSG00000054523.17

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0245, Eukaryota
GeneTreeiENSGT00940000157445
HOGENOMiCLU_009645_0_0_1
InParanoidiO60333
OMAiLHQEDEF
OrthoDBi76316at2759
PhylomeDBiO60333
TreeFamiTF105221

Enzyme and pathway databases

PathwayCommonsiO60333
ReactomeiR-HSA-6811434, COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189, Kinesins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
23095, 3 hits in 872 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KIF1B, human
EvolutionaryTraceiO60333

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KIF1B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23095
PharosiO60333, Tbio

Protein Ontology

More...
PROi
PR:O60333
RNActiO60333, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000054523, Expressed in skeletal muscle tissue of rectus abdominis and 235 other tissues
ExpressionAtlasiO60333, baseline and differential
GenevisibleiO60333, HS

Family and domain databases

CDDicd00060, FHA, 1 hit
Gene3Di2.30.29.30, 1 hit
3.40.850.10, 1 hit
InterProiView protein in InterPro
IPR000253, FHA_dom
IPR022164, Kinesin-like
IPR027640, Kinesin-like_fam
IPR022140, Kinesin-like_KIF1-typ
IPR032405, Kinesin_assoc
IPR019821, Kinesin_motor_CS
IPR001752, Kinesin_motor_dom
IPR036961, Kinesin_motor_dom_sf
IPR027417, P-loop_NTPase
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR008984, SMAD_FHA_dom_sf
PANTHERiPTHR24115, PTHR24115, 1 hit
PfamiView protein in Pfam
PF12473, DUF3694, 1 hit
PF00498, FHA, 1 hit
PF12423, KIF1B, 1 hit
PF00225, Kinesin, 1 hit
PF16183, Kinesin_assoc, 1 hit
PF00169, PH, 1 hit
PRINTSiPR00380, KINESINHEAVY
SMARTiView protein in SMART
SM00240, FHA, 1 hit
SM00129, KISc, 1 hit
SM00233, PH, 1 hit
SUPFAMiSSF49879, SSF49879, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50006, FHA_DOMAIN, 1 hit
PS00411, KINESIN_MOTOR_1, 1 hit
PS50067, KINESIN_MOTOR_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKIF1B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O60333
Secondary accession number(s): A6NFS8
, A6NKQ4, Q4VXC3, Q4VXC4, Q4VXC5, Q4VXC6, Q96Q94, Q9BV80, Q9P280
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: October 17, 2006
Last modified: February 10, 2021
This is version 216 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again