Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O60259 (KLK8_HUMAN)

Entry version 170 (08 May 2019)
Sequence version 1 (01 Aug 1998)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Kallikrein-8

Gene

KLK8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.1 Publication

Miscellaneous

Expressed at high levels in serum, ascites fluid and tumor cytosol of advanced stage ovarian cancer patients and may serve as a marker of ovarian cancer.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by a range of serine protease inhibitors including antipain, aprotinin, leupeptin, benzamidine and soybean trypsin inhibitor.1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.07 mM for Pro-Phe-Arg-MCA1 Publication
  2. KM=0.07 mM for Z-Val-Val-Arg-MCA1 Publication
  3. KM=0.07 mM for Boc-Val-Pro-Arg-MCA1 Publication
  4. KM=0.10 mM for Boc-Leu-Lys-Arg-MCA1 Publication
  5. KM=0.10 mM for Boc-Val-Leu-Lys-MCA1 Publication
  6. KM=0.07 mM for Boc-Phe-Ser-Arg-MCA1 Publication
  1. Vmax=7.1 µmol/min/mg enzyme toward Pro-Phe-Arg-MCA1 Publication
  2. Vmax=5.4 µmol/min/mg enzyme toward Z-Val-Val-Arg-MCA1 Publication
  3. Vmax=3.9 µmol/min/mg enzyme toward Boc-Val-Pro-Arg-MCA1 Publication
  4. Vmax=2.6 µmol/min/mg enzyme toward Boc-Leu-Lys-Arg-MCA1 Publication
  5. Vmax=1.9 µmol/min/mg enzyme toward Boc-Val-Leu-Lys-MCA1 Publication
  6. Vmax=1.6 µmol/min/mg enzyme toward Boc-Phe-Ser-Arg-MCA1 Publication

pH dependencei

Optimum pH is 8.5. Active from pH 7-10.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei73Charge relay systemBy similarity1
Active sitei120Charge relay systemBy similarity1
Active sitei212Charge relay systemBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Serine protease

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.4.21.118 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6809371 Formation of the cornified envelope

Protein family/group databases

MEROPS protease database

More...MEROPSi		S01.244

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kallikrein-8 (EC:3.4.21.118)
Short name:
hK8
Alternative name(s):
Neuropsin
Short name:
NP
Ovasin
Serine protease 19
Serine protease TADG-14
Tumor-associated differentially expressed gene 14 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KLK8
Synonyms:NRPN, PRSS19, TADG14
ORF Names:UNQ283/PRO322
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6369 KLK8

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605644 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O60259

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		11202

Open Targets

More...OpenTargetsi		ENSG00000129455

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30158

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4812

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KLK8

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 28Sequence analysisAdd BLAST28
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002794629 – 32By similarity4
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002794733 – 260Kallikrein-8Add BLAST228

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi39 ↔ 173PROSITE-ProRule annotation
Disulfide bondi58 ↔ 74PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi110N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi145 ↔ 246PROSITE-ProRule annotation
Disulfide bondi152 ↔ 218PROSITE-ProRule annotation
Disulfide bondi184 ↔ 198PROSITE-ProRule annotation
Disulfide bondi208 ↔ 233PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O60259

PeptideAtlas

More...PeptideAtlasi		O60259

PRoteomics IDEntifications database

More...PRIDEi		O60259

ProteomicsDB human proteome resource

More...ProteomicsDBi		49286
49287 [O60259-2]
49288 [O60259-3]
49289 [O60259-4]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O60259

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and kidney but not in spleen, liver, lung or normal ovarian tissue. Displays an 11.5-fold increase in Alzheimer disease hippocampus compared to controls and is overexpressed in some ovarian carcinomas. Expressed at low levels in normal skin while high levels are found in psoriasis vulgaris, seborrheic keratosis, lichen planus and squamous cell carcinoma skin samples. Expressed in the keratinocytes.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000129455 Expressed in 105 organ(s), highest expression level in lower esophagus mucosa

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O60259 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O60259 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB019393
HPA035761

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SPINK9.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		116371, 17 interactors

Protein interaction database and analysis system

More...IntActi		O60259, 9 interactors

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O60259

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1260
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5MS3X-ray2.30A33-260[»]
5MS4X-ray2.10A/B/C/D33-260[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O60259

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini33 – 257Peptidase S1PROSITE-ProRule annotationAdd BLAST225

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182707

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O60259

KEGG Orthology (KO)

More...KOi		K08650

Identification of Orthologs from Complete Genome Data

More...OMAi		TKLYAEN

Database of Orthologous Groups

More...OrthoDBi		1314811at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O60259

TreeFam database of animal gene trees

More...TreeFami		TF331065

Family and domain databases

Conserved Domains Database

More...CDDi		cd00190 Tryp_SPc, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00089 Trypsin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00722 CHYMOTRYPSIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00020 Tryp_SPc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50494 SSF50494, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O60259-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRPRPRAAK TWMFLLLLGG AWAGHSRAQE DKVLGGHECQ PHSQPWQAAL 
        60         70         80         90        100
FQGQQLLCGG VLVGGNWVLT AAHCKKPKYT VRLGDHSLQN KDGPEQEIPV 
       110        120        130        140        150
VQSIPHPCYN SSDVEDHNHD LMLLQLRDQA SLGSKVKPIS LADHCTQPGQ 
       160        170        180        190        200
KCTVSGWGTV TSPRENFPDT LNCAEVKIFP QKKCEDAYPG QITDGMVCAG 
       210        220        230        240        250
SSKGADTCQG DSGGPLVCDG ALQGITSWGS DPCGRSDKPG VYTNICRYLD 
       260
WIKKIIGSKG
Length:260
Mass (Da):28,048
Last modified:August 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEF439E5B8C83E660
GO
Isoform 2 (identifier: O60259-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-23: A → AACGSLDLLTKLYAENLPCVHLNPQWPSQPSHCPRGWRSNPLPPAA

Note: Produced as a result of a human-specific mutation which is not found in other primates.
Show »
Length:305
Mass (Da):32,966
Checksum:i2972CED7B2706AF0
GO
Isoform 3 (identifier: O60259-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-164: Missing.

Show »
Length:119
Mass (Da):12,719
Checksum:i2FD8164DF1641FFF
GO
Isoform 4 (identifier: O60259-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-32: HSRAQEDK → RFWRPPGV
     33-260: Missing.

Show »
Length:32
Mass (Da):3,653
Checksum:i905DA8F5F9C8A664
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R231M0R231_HUMAN
Kallikrein-8
KLK8
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MQY9A0A0A0MQY9_HUMAN
Kallikrein-8
KLK8
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R390M0R390_HUMAN
Kallikrein-8
KLK8
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti195G → V in AAH40887 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051855154V → I. Corresponds to variant dbSNP:rs16988799Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00540123A → AACGSLDLLTKLYAENLPCV HLNPQWPSQPSHCPRGWRSN PLPPAA in isoform 2. 1 Publication1
Alternative sequenceiVSP_03035024 – 164Missing in isoform 3. 1 PublicationAdd BLAST141
Alternative sequenceiVSP_03035125 – 32HSRAQEDK → RFWRPPGV in isoform 4. Curated8
Alternative sequenceiVSP_03035233 – 260Missing in isoform 4. CuratedAdd BLAST228

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB009849 mRNA Translation: BAA28673.1
AB012761 Genomic DNA Translation: BAA28676.1
AF055982 mRNA Translation: AAD56050.1
AB008390 mRNA Translation: BAA82665.1
AB008927 mRNA Translation: BAA82666.1
AB010780 Genomic DNA Translation: BAA88684.1
AF243527 Genomic DNA Translation: AAG33361.1
AF251125 Genomic DNA Translation: AAF79144.1
AF251125 Genomic DNA Translation: AAF79145.1
AF095742 mRNA Translation: AAD25979.1
AF095743 Genomic DNA Translation: AAD29574.1
DQ267420 mRNA Translation: ABB83339.1
AY359036 mRNA Translation: AAQ89395.1
AC011473 Genomic DNA Translation: AAG23254.1
AC011483 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW71962.1
BC040887 mRNA Translation: AAH40887.1
AY563055 Genomic DNA Translation: AAT76913.1
AY563055 Genomic DNA Translation: AAT76914.1
AY563056 Genomic DNA Translation: AAT76915.1
AY563056 Genomic DNA Translation: AAT76916.1
AY563057 Genomic DNA Translation: AAT76917.1
AY563057 Genomic DNA Translation: AAT76918.1
AY563058 Genomic DNA Translation: AAT76919.1
AY563058 Genomic DNA Translation: AAT76920.1
AY563059 Genomic DNA Translation: AAT76921.1
AY563059 Genomic DNA Translation: AAT76922.1
AY563060 Genomic DNA Translation: AAT76923.1
AY563060 Genomic DNA Translation: AAT76924.1
AY563061 Genomic DNA Translation: AAT76925.1
AY563061 Genomic DNA Translation: AAT76926.1
AY563062 Genomic DNA Translation: AAT76927.1
AY563062 Genomic DNA Translation: AAT76928.1
AY563063 Genomic DNA Translation: AAT76929.1
AY563063 Genomic DNA Translation: AAT76930.1
AY563064 Genomic DNA Translation: AAT76931.1
AY563064 Genomic DNA Translation: AAT76932.1
AY563065 Genomic DNA Translation: AAT76933.1
AY563065 Genomic DNA Translation: AAT76934.1
AY563066 Genomic DNA Translation: AAT76935.1
AY563066 Genomic DNA Translation: AAT76936.1
AY563067 Genomic DNA Translation: AAT76937.1
AY563067 Genomic DNA Translation: AAT76938.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12813.1 [O60259-1]
CCDS12814.1 [O60259-3]
CCDS12815.1 [O60259-4]
CCDS42600.1 [O60259-2]

NCBI Reference Sequences

More...RefSeqi		NP_001268360.1, NM_001281431.1
NP_009127.1, NM_007196.3 [O60259-1]
NP_653088.1, NM_144505.2 [O60259-2]
NP_653089.1, NM_144506.2 [O60259-3]
NP_653090.1, NM_144507.2 [O60259-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000320838; ENSP00000325072; ENSG00000129455 [O60259-4]
ENST00000347619; ENSP00000341555; ENSG00000129455 [O60259-3]
ENST00000391806; ENSP00000375682; ENSG00000129455 [O60259-2]
ENST00000593490; ENSP00000469278; ENSG00000129455 [O60259-4]
ENST00000600767; ENSP00000472016; ENSG00000129455 [O60259-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11202

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:11202

UCSC genome browser

More...UCSCi		uc002puq.2 human [O60259-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009849 mRNA Translation: BAA28673.1
AB012761 Genomic DNA Translation: BAA28676.1
AF055982 mRNA Translation: AAD56050.1
AB008390 mRNA Translation: BAA82665.1
AB008927 mRNA Translation: BAA82666.1
AB010780 Genomic DNA Translation: BAA88684.1
AF243527 Genomic DNA Translation: AAG33361.1
AF251125 Genomic DNA Translation: AAF79144.1
AF251125 Genomic DNA Translation: AAF79145.1
AF095742 mRNA Translation: AAD25979.1
AF095743 Genomic DNA Translation: AAD29574.1
DQ267420 mRNA Translation: ABB83339.1
AY359036 mRNA Translation: AAQ89395.1
AC011473 Genomic DNA Translation: AAG23254.1
AC011483 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW71962.1
BC040887 mRNA Translation: AAH40887.1
AY563055 Genomic DNA Translation: AAT76913.1
AY563055 Genomic DNA Translation: AAT76914.1
AY563056 Genomic DNA Translation: AAT76915.1
AY563056 Genomic DNA Translation: AAT76916.1
AY563057 Genomic DNA Translation: AAT76917.1
AY563057 Genomic DNA Translation: AAT76918.1
AY563058 Genomic DNA Translation: AAT76919.1
AY563058 Genomic DNA Translation: AAT76920.1
AY563059 Genomic DNA Translation: AAT76921.1
AY563059 Genomic DNA Translation: AAT76922.1
AY563060 Genomic DNA Translation: AAT76923.1
AY563060 Genomic DNA Translation: AAT76924.1
AY563061 Genomic DNA Translation: AAT76925.1
AY563061 Genomic DNA Translation: AAT76926.1
AY563062 Genomic DNA Translation: AAT76927.1
AY563062 Genomic DNA Translation: AAT76928.1
AY563063 Genomic DNA Translation: AAT76929.1
AY563063 Genomic DNA Translation: AAT76930.1
AY563064 Genomic DNA Translation: AAT76931.1
AY563064 Genomic DNA Translation: AAT76932.1
AY563065 Genomic DNA Translation: AAT76933.1
AY563065 Genomic DNA Translation: AAT76934.1
AY563066 Genomic DNA Translation: AAT76935.1
AY563066 Genomic DNA Translation: AAT76936.1
AY563067 Genomic DNA Translation: AAT76937.1
AY563067 Genomic DNA Translation: AAT76938.1
CCDSiCCDS12813.1 [O60259-1]
CCDS12814.1 [O60259-3]
CCDS12815.1 [O60259-4]
CCDS42600.1 [O60259-2]
RefSeqiNP_001268360.1, NM_001281431.1
NP_009127.1, NM_007196.3 [O60259-1]
NP_653088.1, NM_144505.2 [O60259-2]
NP_653089.1, NM_144506.2 [O60259-3]
NP_653090.1, NM_144507.2 [O60259-4]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5MS3X-ray2.30A33-260[»]
5MS4X-ray2.10A/B/C/D33-260[»]
SMRiO60259
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116371, 17 interactors
IntActiO60259, 9 interactors

Chemistry databases

BindingDBiO60259
ChEMBLiCHEMBL4812

Protein family/group databases

MEROPSiS01.244

PTM databases

PhosphoSitePlusiO60259

Polymorphism and mutation databases

BioMutaiKLK8

Proteomic databases

EPDiO60259
PeptideAtlasiO60259
PRIDEiO60259
ProteomicsDBi49286
49287 [O60259-2]
49288 [O60259-3]
49289 [O60259-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		11202
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000320838; ENSP00000325072; ENSG00000129455 [O60259-4]
ENST00000347619; ENSP00000341555; ENSG00000129455 [O60259-3]
ENST00000391806; ENSP00000375682; ENSG00000129455 [O60259-2]
ENST00000593490; ENSP00000469278; ENSG00000129455 [O60259-4]
ENST00000600767; ENSP00000472016; ENSG00000129455 [O60259-1]
GeneIDi11202
KEGGihsa:11202
UCSCiuc002puq.2 human [O60259-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		11202
DisGeNETi11202

GeneCards: human genes, protein and diseases

More...GeneCardsi		KLK8
HGNCiHGNC:6369 KLK8
HPAiCAB019393
HPA035761
MIMi605644 gene
neXtProtiNX_O60259
OpenTargetsiENSG00000129455
PharmGKBiPA30158

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00950000182707
InParanoidiO60259
KOiK08650
OMAiTKLYAEN
OrthoDBi1314811at2759
PhylomeDBiO60259
TreeFamiTF331065

Enzyme and pathway databases

BRENDAi3.4.21.118 2681
ReactomeiR-HSA-6809371 Formation of the cornified envelope

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		KLK8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		11202

Protein Ontology

More...PROi		PR:O60259

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000129455 Expressed in 105 organ(s), highest expression level in lower esophagus mucosa
ExpressionAtlasiO60259 baseline and differential
GenevisibleiO60259 HS

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKLK8_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O60259
Secondary accession number(s): Q5V9X1
, Q5V9X2, Q8IW69, Q9HCB3, Q9NR68, Q9NR69, Q9UIL9, Q9UQ47
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: August 1, 1998
Last modified: May 8, 2019
This is version 170 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again