Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase 1 regulatory subunit 12B

Gene

PPP1R12B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates myosin phosphatase activity. Augments Ca2+ sensitivity of the contractile apparatus.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • enzyme activator activity Source: ProtInc
  • enzyme inhibitor activity Source: GO_Central
  • phosphatase regulator activity Source: GO_Central
  • protein kinase binding Source: InterPro

GO - Biological processi

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.3.53 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-5625740 RHO GTPases activate PKNs
R-HSA-5625900 RHO GTPases activate CIT
R-HSA-5627117 RHO GTPases Activate ROCKs
R-HSA-5627123 RHO GTPases activate PAKs

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O60237

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein phosphatase 1 regulatory subunit 12B
Alternative name(s):
Myosin phosphatase-targeting subunit 2
Short name:
Myosin phosphatase target subunit 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPP1R12B
Synonyms:MYPT2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000077157.21

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7619 PPP1R12B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603768 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O60237

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4660

Open Targets

More...
OpenTargetsi
ENSG00000077157

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33618

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PPP1R12B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000670281 – 982Protein phosphatase 1 regulatory subunit 12BAdd BLAST982

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei29PhosphoserineBy similarity1
Modified residuei445PhosphothreonineBy similarity1
Modified residuei646PhosphothreonineCombined sources1
Modified residuei808PhosphothreonineBy similarity1
Modified residuei839PhosphoserineBy similarity1
Modified residuei947PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O60237

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O60237

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O60237

PeptideAtlas

More...
PeptideAtlasi
O60237

PRoteomics IDEntifications database

More...
PRIDEi
O60237

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49262
49263 [O60237-2]
49264 [O60237-3]
49265 [O60237-4]
49266 [O60237-5]

2D gel databases

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
O60237

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O60237

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O60237

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in skeletal muscle, fetal and adult heart, brain, placenta, kidney, spleen, thymus, pancreas and lung. Isoform 3 and isoform 4 are heart specific.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000077157 Expressed in 229 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_PPP1R12B

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O60237 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O60237 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA024171
HPA024640

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

PP1 comprises a catalytic subunit, PPP1CA, PPP1CB or PPP1CC, and one or several targeting or regulatory subunits. PPP1R12B mediates binding to myosin. Isoform 3 and isoform 4 bind PPP1R12A, but not isoform 1 of PPP1R12B itself. Binds IL16.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
PIK3R3Q925692EBI-10700351,EBI-79893

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110743, 25 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
O60237

Protein interaction database and analysis system

More...
IntActi
O60237, 17 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000384496

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O60237

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O60237

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati57 – 86ANK 1Add BLAST30
Repeati90 – 119ANK 2Add BLAST30
Repeati123 – 152ANK 3Add BLAST30
Repeati216 – 245ANK 4Add BLAST30
Repeati249 – 278ANK 5Add BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi336 – 379Glu-richAdd BLAST44

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0505 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157067

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290648

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG059135

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O60237

KEGG Orthology (KO)

More...
KOi
K12329

Identification of Orthologs from Complete Genome Data

More...
OMAi
SYTRQPW

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0UPK

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O60237

TreeFam database of animal gene trees

More...
TreeFami
TF105543

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR017401 MYPT1/MYPT2/Mbs85
IPR031775 PRKG1_interact

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 2 hits
PF15898 PRKG1_interact, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF038141 PP1_12ABC_vert, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O60237-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELEHLGGK RAESARMRRA EQLRRWRGSL TEQEPAERRG AGRQPLTRRG
60 70 80 90 100
SPRVRFEDGA VFLAACSSGD TDEVRKLLAR GADINTVNVD GLTALHQACI
110 120 130 140 150
DENLDMVKFL VENRANVNQQ DNEGWTPLHA AASCGYLNIA EYFINHGASV
160 170 180 190 200
GIVNSEGEVP SDLAEEPAMK DLLLEQVKKQ GVDLEQSRKE EEQQMLQDAR
210 220 230 240 250
QWLNSGKIED VRQARSGATA LHVAAAKGYS EVLRLLIQAG YELNVQDYDG
260 270 280 290 300
WTPLHAAAHW GVKEACSILA EALCDMDIRN KLGQTPFDVA DEGLVEHLEL
310 320 330 340 350
LQKKQNVLRS EKETRNKLIE SDLNSKIQSG FFKNKEKMLY EEETPKSQEM
360 370 380 390 400
EEENKESSSS SSEEEEGEDE ASESETEKEA DKKPEAFVNH SNSESKSSIT
410 420 430 440 450
EQIPAPAQNT FSASSARRFS SGLFNKPEEP KDESPSSWRL GLRKTGSHNM
460 470 480 490 500
LSEVANSREP IRDRGSSIYR SSSSPRISAL LDNKDKEREN KSYISSLAPR
510 520 530 540 550
KLNSTSDIEE KENRESAVNL VRSGSYTRQL WRDEAKGNEI PQTIAPSTYV
560 570 580 590 600
STYLKRTPHK SQADTTAEKT ADNVSSSTPL CVITNRPLPS TANGVTATPV
610 620 630 640 650
LSITGTDSSV EAREKRRSYL TPVRDEEAES LRKARSRQAR QTRRSTQGVT
660 670 680 690 700
LTDLQEAERT FSRSRAERQA QEQPREKPTD TEGLEGSPEK HEPSAVPATE
710 720 730 740 750
AGEGQQPWGR SLDEEPICHR LRCPAQPDKP TTPASPSTSR PSLYTSSHLL
760 770 780 790 800
WTNRFSVPDS ESSETTTNTT TAKEMDKNEN EEADLDEQSS KRLSIRERRR
810 820 830 840 850
PKERRRGTGI NFWTKDEDET DGSEEVKETW HERLSRLESG GSNPTTSDSY
860 870 880 890 900
GDRASARARR EAREARLATL TSRVEEDSNR DYKKLYESAL TENQKLKTKL
910 920 930 940 950
QEAQLELADI KSKLEKVAQQ KQEKTSDRSS VLEMEKRERR ALERKMSEME
960 970 980
EEMKVLTELK SDNQRLKDEN GALIRVISKL SK
Note: Produced by alternative promoter usage.
Length:982
Mass (Da):110,404
Last modified:November 28, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA6EBB6AD4C61DD3B
GO
Isoform 2 (identifier: O60237-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-386: DKKPEA → VLFWPF
     387-982: Missing.

Note: Produced by alternative splicing of isoform 1. No experimental confirmation available.
Show »
Length:386
Mass (Da):43,260
Checksum:iC2552EEF1F03C733
GO
Isoform 3 (identifier: O60237-3) [UniParc]FASTAAdd to basket
Also known as: hHS-M21B, Heart-specific myosin light chain phosphatase small subunit B

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.
     955-982: VLTELKSDNQRLKDENGALIRVISKLSK → NLHQLKQIQTLKQMNEQLQAENRALTRVVARLSESIESSDTQEL

Note: Produced by alternative splicing of isoform 4.
Show »
Length:224
Mass (Da):26,262
Checksum:i64CC09C60F7366B3
GO
Isoform 4 (identifier: O60237-4) [UniParc]FASTAAdd to basket
Also known as: hHS-M21A, Heart-specific myosin light chain phosphatase small subunit A

The sequence of this isoform differs from the canonical sequence as follows:
     1-774: Missing.

Note: Produced by alternative promoter usage.
Show »
Length:208
Mass (Da):24,338
Checksum:i0878B07EE0661A25
GO
Isoform 5 (identifier: O60237-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     487-515: ERENKSYISSLAPRKLNSTSDIEEKENRE → VQFGRVWGNSKAVFFFHENSILGTNENIF
     516-982: Missing.

Note: No experimental confirmation available.
Show »
Length:515
Mass (Da):57,501
Checksum:i8B672C86E4A1F951
GO
Isoform 6 (identifier: O60237-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     555-555: K → KSASFGRSSDPTSPYISANRNSSPATSPITIGSSTSRGSQWQPASSCPAPISANTTASVHHG

Show »
Length:1,043
Mass (Da):116,504
Checksum:iFD88A339B689C178
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E1CKY7E1CKY7_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R12B sm-M20
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4R6H7C4R6_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R12B
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6GQY8Q6GQY8_HUMAN
PPP1R12B protein
PPP1R12B
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQI8A0A0U1RQI8_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R12B
20Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQP2A0A0U1RQP2_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R12B
8Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_017480182V → I2 PublicationsCorresponds to variant dbSNP:rs2843414Ensembl.1
Natural variantiVAR_024177836R → K. Corresponds to variant dbSNP:rs3881953Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0092561 – 774Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST774
Alternative sequenceiVSP_009257381 – 386DKKPEA → VLFWPF in isoform 2. 1 Publication6
Alternative sequenceiVSP_009258387 – 982Missing in isoform 2. 1 PublicationAdd BLAST596
Alternative sequenceiVSP_043159487 – 515ERENK…KENRE → VQFGRVWGNSKAVFFFHENS ILGTNENIF in isoform 5. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_043160516 – 982Missing in isoform 5. 1 PublicationAdd BLAST467
Alternative sequenceiVSP_059344555K → KSASFGRSSDPTSPYISANR NSSPATSPITIGSSTSRGSQ WQPASSCPAPISANTTASVH HG in isoform 6. 1
Alternative sequenceiVSP_009259955 – 982VLTEL…SKLSK → NLHQLKQIQTLKQMNEQLQA ENRALTRVVARLSESIESSD TQEL in isoform 3. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB003062 mRNA Translation: BAA28376.1
AF324888 mRNA Translation: AAK00337.1
AF324892
, AF324889, AF324890, AF324891 Genomic DNA Translation: AAK00336.1
AB050641 mRNA Translation: BAB17610.1
AB050642 mRNA Translation: BAB17611.1
AC099336 Genomic DNA No translation available.
AL356953 Genomic DNA No translation available.
AL589762 Genomic DNA No translation available.
AC118556 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91418.1
BC034430 mRNA Translation: AAH34430.1
BC110907 mRNA Translation: AAI10908.1
BC144699 mRNA Translation: AAI44700.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1426.1 [O60237-1]
CCDS44294.1 [O60237-4]
CCDS44295.1 [O60237-3]
CCDS53458.1 [O60237-5]
CCDS53459.1 [O60237-2]
CCDS81416.1 [O60237-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001161329.1, NM_001167857.1 [O60237-5]
NP_001161330.1, NM_001167858.1 [O60237-2]
NP_001184060.1, NM_001197131.1
NP_001317958.1, NM_001331029.1 [O60237-6]
NP_002472.2, NM_002481.3 [O60237-1]
NP_115286.1, NM_032103.2 [O60237-4]
NP_115287.1, NM_032104.2 [O60237-3]
XP_016856841.1, XM_017001352.1 [O60237-3]
XP_016856842.1, XM_017001353.1 [O60237-4]
XP_016856843.1, XM_017001354.1 [O60237-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.444403
Hs.677346

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000290419; ENSP00000484005; ENSG00000077157 [O60237-3]
ENST00000356764; ENSP00000349206; ENSG00000077157 [O60237-2]
ENST00000391959; ENSP00000375821; ENSG00000077157 [O60237-6]
ENST00000480184; ENSP00000417159; ENSG00000077157 [O60237-5]
ENST00000491336; ENSP00000480852; ENSG00000077157 [O60237-4]
ENST00000608999; ENSP00000476755; ENSG00000077157 [O60237-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4660

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4660

UCSC genome browser

More...
UCSCi
uc001gxy.4 human [O60237-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003062 mRNA Translation: BAA28376.1
AF324888 mRNA Translation: AAK00337.1
AF324892
, AF324889, AF324890, AF324891 Genomic DNA Translation: AAK00336.1
AB050641 mRNA Translation: BAB17610.1
AB050642 mRNA Translation: BAB17611.1
AC099336 Genomic DNA No translation available.
AL356953 Genomic DNA No translation available.
AL589762 Genomic DNA No translation available.
AC118556 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91418.1
BC034430 mRNA Translation: AAH34430.1
BC110907 mRNA Translation: AAI10908.1
BC144699 mRNA Translation: AAI44700.1
CCDSiCCDS1426.1 [O60237-1]
CCDS44294.1 [O60237-4]
CCDS44295.1 [O60237-3]
CCDS53458.1 [O60237-5]
CCDS53459.1 [O60237-2]
CCDS81416.1 [O60237-6]
RefSeqiNP_001161329.1, NM_001167857.1 [O60237-5]
NP_001161330.1, NM_001167858.1 [O60237-2]
NP_001184060.1, NM_001197131.1
NP_001317958.1, NM_001331029.1 [O60237-6]
NP_002472.2, NM_002481.3 [O60237-1]
NP_115286.1, NM_032103.2 [O60237-4]
NP_115287.1, NM_032104.2 [O60237-3]
XP_016856841.1, XM_017001352.1 [O60237-3]
XP_016856842.1, XM_017001353.1 [O60237-4]
XP_016856843.1, XM_017001354.1 [O60237-3]
UniGeneiHs.444403
Hs.677346

3D structure databases

ProteinModelPortaliO60237
SMRiO60237
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110743, 25 interactors
ELMiO60237
IntActiO60237, 17 interactors
STRINGi9606.ENSP00000384496

PTM databases

iPTMnetiO60237
PhosphoSitePlusiO60237

Polymorphism and mutation databases

BioMutaiPPP1R12B

2D gel databases

UCD-2DPAGEiO60237

Proteomic databases

EPDiO60237
MaxQBiO60237
PaxDbiO60237
PeptideAtlasiO60237
PRIDEiO60237
ProteomicsDBi49262
49263 [O60237-2]
49264 [O60237-3]
49265 [O60237-4]
49266 [O60237-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4660
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000290419; ENSP00000484005; ENSG00000077157 [O60237-3]
ENST00000356764; ENSP00000349206; ENSG00000077157 [O60237-2]
ENST00000391959; ENSP00000375821; ENSG00000077157 [O60237-6]
ENST00000480184; ENSP00000417159; ENSG00000077157 [O60237-5]
ENST00000491336; ENSP00000480852; ENSG00000077157 [O60237-4]
ENST00000608999; ENSP00000476755; ENSG00000077157 [O60237-1]
GeneIDi4660
KEGGihsa:4660
UCSCiuc001gxy.4 human [O60237-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4660
DisGeNETi4660
EuPathDBiHostDB:ENSG00000077157.21

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PPP1R12B
HGNCiHGNC:7619 PPP1R12B
HPAiHPA024171
HPA024640
MIMi603768 gene
neXtProtiNX_O60237
OpenTargetsiENSG00000077157
PharmGKBiPA33618

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0505 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000157067
HOGENOMiHOG000290648
HOVERGENiHBG059135
InParanoidiO60237
KOiK12329
OMAiSYTRQPW
OrthoDBiEOG091G0UPK
PhylomeDBiO60237
TreeFamiTF105543

Enzyme and pathway databases

BRENDAi3.1.3.53 2681
ReactomeiR-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-5625740 RHO GTPases activate PKNs
R-HSA-5625900 RHO GTPases activate CIT
R-HSA-5627117 RHO GTPases Activate ROCKs
R-HSA-5627123 RHO GTPases activate PAKs
SIGNORiO60237

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PPP1R12B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PPP1R12B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4660

Protein Ontology

More...
PROi
PR:O60237

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000077157 Expressed in 229 organ(s), highest expression level in corpus callosum
CleanExiHS_PPP1R12B
ExpressionAtlasiO60237 baseline and differential
GenevisibleiO60237 HS

Family and domain databases

CDDicd00204 ANK, 2 hits
Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR017401 MYPT1/MYPT2/Mbs85
IPR031775 PRKG1_interact
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF15898 PRKG1_interact, 1 hit
PIRSFiPIRSF038141 PP1_12ABC_vert, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 5 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYPT2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O60237
Secondary accession number(s): A0A0A0MS24
, A8MYF5, B7ZMN6, Q2TAI8, Q5T506, Q5VUK2, Q8N179, Q9HCB7, Q9HCB8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: November 28, 2006
Last modified: December 5, 2018
This is version 157 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again