Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein SSX5

Gene

SSX5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Could act as a modulator of transcription.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein SSX5
Gene namesi
Name:SSX5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000165583.13
HGNCiHGNC:11339 SSX5
MIMi300327 gene
neXtProtiNX_O60225

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi6758
OpenTargetsiENSG00000165583
PharmGKBiPA36163

Polymorphism and mutation databases

BioMutaiSSX5

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001818321 – 188Protein SSX5Add BLAST188

Proteomic databases

PeptideAtlasiO60225
PRIDEiO60225
ProteomicsDBi49250
49251 [O60225-2]

PTM databases

iPTMnetiO60225
PhosphoSitePlusiO60225

Expressioni

Gene expression databases

BgeeiENSG00000165583 Expressed in 20 organ(s), highest expression level in heart left ventricle
CleanExiHS_SSX5
ExpressionAtlasiO60225 baseline and differential
GenevisibleiO60225 HS

Organism-specific databases

HPAiHPA045683

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
AGTRAPQ6RW133EBI-10186198,EBI-741181

Protein-protein interaction databases

BioGridi112636, 5 interactors
IntActiO60225, 5 interactors

Structurei

3D structure databases

ProteinModelPortaliO60225
SMRiO60225
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 83KRAB-relatedPROSITE-ProRule annotationAdd BLAST64

Sequence similaritiesi

Belongs to the SSX family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000012484
HOGENOMiHOG000231461
HOVERGENiHBG002056
InParanoidiO60225
OMAiTLPAFMC
OrthoDBiEOG091G0NPV
PhylomeDBiO60225
TreeFamiTF338517

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR003655 Krueppel-associated_box-rel
IPR028804 SSX
IPR019041 SSXRD_motif
PANTHERiPTHR14112 PTHR14112, 2 hits
PfamiView protein in Pfam
PF09514 SSXRD, 1 hit
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SUPFAMiSSF109640 SSF109640, 1 hit
PROSITEiView protein in PROSITE
PS50806 KRAB_RELATED, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O60225-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGDDAFVRR PRVGSQIPEK MQKAFDDIAK YFSEKEWEKM KASEKIIYVY
60 70 80 90 100
MKRKYEAMTK LGFKATLPPF MRNKRVADFQ GNDFDNDPNR GNQVEHPQMT
110 120 130 140 150
FGRLQGIFPK ITPEKPAEEG NDSKGVPEAS GPQNNGKQLR PSGKLNTSEK
160 170 180
VNKTSGPKRG KHAWTHRVRE RKQLVIYEEI SDPQEDDE
Length:188
Mass (Da):21,660
Last modified:October 3, 2006 - v3
Checksum:iDBFA61D8B1295A27
GO
Isoform 2 (identifier: O60225-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-23: K → KHPWRQVCDRGIHLVNLSPFWKVGREPASSIKALLCGRGEAR

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):26,284
Checksum:iF2EC22A6B5C02F08
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JQ63Q5JQ63_HUMAN
Protein SSX5
SSX5 RP11-38O23.8-003
128Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti184Q → P in AAC05821 (PubMed:9378559).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02780519E → Q2 PublicationsCorresponds to variant dbSNP:rs4824675Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00627423K → KHPWRQVCDRGIHLVNLSPF WKVGREPASSIKALLCGRGE AR in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U90842 mRNA Translation: AAC05821.1
AL683817, AL356464 Genomic DNA Translation: CAI41133.1
AL683817, AL356464 Genomic DNA Translation: CAI41134.1
AL356464, AL683817 Genomic DNA Translation: CAI40523.1
AL356464, AL683817 Genomic DNA Translation: CAI40524.1
BC016640 mRNA Translation: AAH16640.1
CCDSiCCDS14288.1 [O60225-2]
CCDS14289.1 [O60225-1]
RefSeqiNP_066295.3, NM_021015.3 [O60225-2]
NP_783729.1, NM_175723.1 [O60225-1]
XP_011542251.1, XM_011543949.2 [O60225-1]
XP_016885247.1, XM_017029758.1 [O60225-1]
UniGeneiHs.166198

Genome annotation databases

EnsembliENST00000311798; ENSP00000312415; ENSG00000165583 [O60225-2]
ENST00000347757; ENSP00000290558; ENSG00000165583 [O60225-1]
ENST00000376923; ENSP00000366122; ENSG00000165583 [O60225-1]
GeneIDi6758
KEGGihsa:6758
UCSCiuc004diz.1 human [O60225-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U90842 mRNA Translation: AAC05821.1
AL683817, AL356464 Genomic DNA Translation: CAI41133.1
AL683817, AL356464 Genomic DNA Translation: CAI41134.1
AL356464, AL683817 Genomic DNA Translation: CAI40523.1
AL356464, AL683817 Genomic DNA Translation: CAI40524.1
BC016640 mRNA Translation: AAH16640.1
CCDSiCCDS14288.1 [O60225-2]
CCDS14289.1 [O60225-1]
RefSeqiNP_066295.3, NM_021015.3 [O60225-2]
NP_783729.1, NM_175723.1 [O60225-1]
XP_011542251.1, XM_011543949.2 [O60225-1]
XP_016885247.1, XM_017029758.1 [O60225-1]
UniGeneiHs.166198

3D structure databases

ProteinModelPortaliO60225
SMRiO60225
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112636, 5 interactors
IntActiO60225, 5 interactors

PTM databases

iPTMnetiO60225
PhosphoSitePlusiO60225

Polymorphism and mutation databases

BioMutaiSSX5

Proteomic databases

PeptideAtlasiO60225
PRIDEiO60225
ProteomicsDBi49250
49251 [O60225-2]

Protocols and materials databases

DNASUi6758
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311798; ENSP00000312415; ENSG00000165583 [O60225-2]
ENST00000347757; ENSP00000290558; ENSG00000165583 [O60225-1]
ENST00000376923; ENSP00000366122; ENSG00000165583 [O60225-1]
GeneIDi6758
KEGGihsa:6758
UCSCiuc004diz.1 human [O60225-1]

Organism-specific databases

CTDi6758
DisGeNETi6758
EuPathDBiHostDB:ENSG00000165583.13
GeneCardsiSSX5
HGNCiHGNC:11339 SSX5
HPAiHPA045683
MIMi300327 gene
neXtProtiNX_O60225
OpenTargetsiENSG00000165583
PharmGKBiPA36163
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000012484
HOGENOMiHOG000231461
HOVERGENiHBG002056
InParanoidiO60225
OMAiTLPAFMC
OrthoDBiEOG091G0NPV
PhylomeDBiO60225
TreeFamiTF338517

Miscellaneous databases

ChiTaRSiSSX5 human
GeneWikiiSSX5
GenomeRNAii6758
PROiPR:O60225
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000165583 Expressed in 20 organ(s), highest expression level in heart left ventricle
CleanExiHS_SSX5
ExpressionAtlasiO60225 baseline and differential
GenevisibleiO60225 HS

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR003655 Krueppel-associated_box-rel
IPR028804 SSX
IPR019041 SSXRD_motif
PANTHERiPTHR14112 PTHR14112, 2 hits
PfamiView protein in Pfam
PF09514 SSXRD, 1 hit
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SUPFAMiSSF109640 SSF109640, 1 hit
PROSITEiView protein in PROSITE
PS50806 KRAB_RELATED, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSSX5_HUMAN
AccessioniPrimary (citable) accession number: O60225
Secondary accession number(s): Q5JQ59, Q5JQ60, Q96AW3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: October 3, 2006
Last modified: September 12, 2018
This is version 149 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again