Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptogyrin-1

Gene

Syngr1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity). Involved in the regulation of short-term and long-term synaptic plasticity (PubMed:10595519).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-6798695 Neutrophil degranulation

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.130.2.5 the tetraspan vesicle membrane protein (tvp) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptogyrin-1Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Syngr1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1328323 Syngr1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 23CytoplasmicBy similarityAdd BLAST23
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei24 – 44HelicalSequence analysisAdd BLAST21
Topological domaini45 – 71LumenalBy similarityAdd BLAST27
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 103CytoplasmicBy similarityAdd BLAST11
Transmembranei104 – 124HelicalSequence analysisAdd BLAST21
Topological domaini125 – 148LumenalBy similarityAdd BLAST24
Transmembranei149 – 169HelicalSequence analysisAdd BLAST21
Topological domaini170 – 234CytoplasmicBy similarityAdd BLAST65

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice lacking both Syngr1 and Syp show normal brain structure and composition, but impaired short-term and long-term synaptic plasticity.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001839911 – 234Synaptogyrin-1Add BLAST234

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O55100

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O55100

PeptideAtlas

More...
PeptideAtlasi
O55100

PRoteomics IDEntifications database

More...
PRIDEi
O55100

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O55100

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O55100

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022415 Expressed in 247 organ(s), highest expression level in camera-type eye

CleanEx database of gene expression profiles

More...
CleanExi
MM_SYNGR1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O55100 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O55100 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
203605, 1 interactor

Protein interaction database and analysis system

More...
IntActi
O55100, 3 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000009727

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 173MARVELPROSITE-ProRule annotationAdd BLAST154

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the synaptogyrin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4016 Eukaryota
ENOG4111F8S LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154207

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220816

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000896

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O55100

Identification of Orthologs from Complete Genome Data

More...
OMAi
WSQWSSA

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0KKK

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O55100

TreeFam database of animal gene trees

More...
TreeFami
TF320995

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008253 Marvel
IPR016579 Synaptogyrin

The PANTHER Classification System

More...
PANTHERi
PTHR10838 PTHR10838, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01284 MARVEL, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF011282 Synaptogyrin, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51225 MARVEL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1A (identifier: O55100-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGGAYGAGK AGGAFDPYTL VRQPHTILRV VSWVFSIVVF GSIVNEGYLN
60 70 80 90 100
NPEEEEEFCI YNRNPNACSY GVTVGVLAFL TCLLYLALDV YFPQISSVKD
110 120 130 140 150
RKKAVLSDIG VSAFWAFFWF VGFCFLANQW QVSKPKDNPL NEGTDAARAA
160 170 180 190 200
IAFSFFSIFT WAGQAVLAFQ RYQIGADSAL FSQDYMDPSQ DSSMPYAPYV
210 220 230
EPSAGSDPAG MGGTYQHPAN AFDAEPQGYQ SQGY
Length:234
Mass (Da):25,653
Last modified:May 15, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i09566021DF3E809A
GO
Isoform 1B (identifier: O55100-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-234: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKELTFQEEYNTLFPASAQP

Show »
Length:191
Mass (Da):21,294
Checksum:i966472837A0A1919
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YWY9D3YWY9_MOUSE
Synaptogyrin-1
Syngr1
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6PZA3F6PZA3_MOUSE
Synaptogyrin-1
Syngr1
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006333162 – 234AGQAV…QSQGY → SLTAALAVRRFKELTFQEEY NTLFPASAQP in isoform 1B. 2 PublicationsAdd BLAST73

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ002306 mRNA Translation: CAA05323.1
AK002972 mRNA Translation: BAB22487.1
AK010442 mRNA Translation: BAB26943.1
AK044007 mRNA Translation: BAC31736.1
BC138728 mRNA Translation: AAI38729.1
BC138729 mRNA Translation: AAI38730.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS27657.1 [O55100-1]
CCDS27658.1 [O55100-2]

NCBI Reference Sequences

More...
RefSeqi
NP_033329.1, NM_009303.2 [O55100-2]
NP_997591.1, NM_207708.1 [O55100-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.230301
Mm.396243

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000009727; ENSMUSP00000009727; ENSMUSG00000022415 [O55100-1]
ENSMUST00000009728; ENSMUSP00000009728; ENSMUSG00000022415 [O55100-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
20972

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:20972

UCSC genome browser

More...
UCSCi
uc007wvd.1 mouse [O55100-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002306 mRNA Translation: CAA05323.1
AK002972 mRNA Translation: BAB22487.1
AK010442 mRNA Translation: BAB26943.1
AK044007 mRNA Translation: BAC31736.1
BC138728 mRNA Translation: AAI38729.1
BC138729 mRNA Translation: AAI38730.1
CCDSiCCDS27657.1 [O55100-1]
CCDS27658.1 [O55100-2]
RefSeqiNP_033329.1, NM_009303.2 [O55100-2]
NP_997591.1, NM_207708.1 [O55100-1]
UniGeneiMm.230301
Mm.396243

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Protein-protein interaction databases

BioGridi203605, 1 interactor
IntActiO55100, 3 interactors
STRINGi10090.ENSMUSP00000009727

Protein family/group databases

TCDBi9.B.130.2.5 the tetraspan vesicle membrane protein (tvp) family

PTM databases

iPTMnetiO55100
PhosphoSitePlusiO55100

Proteomic databases

MaxQBiO55100
PaxDbiO55100
PeptideAtlasiO55100
PRIDEiO55100

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000009727; ENSMUSP00000009727; ENSMUSG00000022415 [O55100-1]
ENSMUST00000009728; ENSMUSP00000009728; ENSMUSG00000022415 [O55100-2]
GeneIDi20972
KEGGimmu:20972
UCSCiuc007wvd.1 mouse [O55100-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9145
MGIiMGI:1328323 Syngr1

Phylogenomic databases

eggNOGiKOG4016 Eukaryota
ENOG4111F8S LUCA
GeneTreeiENSGT00940000154207
HOGENOMiHOG000220816
HOVERGENiHBG000896
InParanoidiO55100
OMAiWSQWSSA
OrthoDBiEOG091G0KKK
PhylomeDBiO55100
TreeFamiTF320995

Enzyme and pathway databases

ReactomeiR-MMU-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Syngr1 mouse

Protein Ontology

More...
PROi
PR:O55100

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022415 Expressed in 247 organ(s), highest expression level in camera-type eye
CleanExiMM_SYNGR1
ExpressionAtlasiO55100 baseline and differential
GenevisibleiO55100 MM

Family and domain databases

InterProiView protein in InterPro
IPR008253 Marvel
IPR016579 Synaptogyrin
PANTHERiPTHR10838 PTHR10838, 1 hit
PfamiView protein in Pfam
PF01284 MARVEL, 1 hit
PIRSFiPIRSF011282 Synaptogyrin, 1 hit
PROSITEiView protein in PROSITE
PS51225 MARVEL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNG1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O55100
Secondary accession number(s): B9EI16, Q543Y5, Q9DCB0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 15, 2002
Last modified: December 5, 2018
This is version 140 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again