Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RalBP1-associated Eps domain-containing protein 1

Gene

Reps1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May coordinate the cellular actions of activated EGF receptors and Ral-GTPases.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi331 – 342PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-8856825 Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828 Clathrin-mediated endocytosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RalBP1-associated Eps domain-containing protein 1
Alternative name(s):
RalBP1-interacting protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Reps1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1196373 Reps1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Coated pit, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000738301 – 795RalBP1-associated Eps domain-containing protein 1Add BLAST795

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei145PhosphoserineBy similarity1
Modified residuei162PhosphoserineBy similarity1
Modified residuei166PhosphoserineBy similarity1
Modified residuei170PhosphoserineBy similarity1
Modified residuei173PhosphothreonineBy similarity1
Modified residuei272PhosphoserineCombined sources1
Modified residuei273PhosphoserineCombined sources1
Modified residuei288PhosphotyrosineSequence analysis1
Modified residuei307PhosphoserineBy similarity1
Modified residuei475PhosphoserineBy similarity1
Modified residuei482PhosphoserineBy similarity1
Modified residuei489PhosphoserineBy similarity1
Modified residuei539PhosphoserineCombined sources1
Modified residuei543PhosphothreonineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei708PhosphoserineCombined sources1
Modified residuei739PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

EGF stimulates phosphorylation on Tyr-residues.

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O54916

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O54916

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O54916

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O54916

PeptideAtlas

More...
PeptideAtlasi
O54916

PRoteomics IDEntifications database

More...
PRIDEi
O54916

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O54916

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O54916

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues examined. The highest level expression was found in the kidney and testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000019854 Expressed in 286 organ(s), highest expression level in submandibular gland

CleanEx database of gene expression profiles

More...
CleanExi
MM_REPS1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O54916 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O54916 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (Potential). Interacts with RALBP1, CRK and GRB2. Binding to RALBP1 does not affect its Ral-binding activity. Forms a complex with the SH3 domains of CRK and GRB2 which may link it to an EGF-responsive tyrosine kinase. Interacts with RAB11FIP2 (By similarity). Interacts with AMPH, ITSN1 (via SH3 domains) and SGIP1; may be involved in clathrin-mediated endocytosis (By similarity).By similarityCurated

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
202861, 1 interactor

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O54916

Protein interaction database and analysis system

More...
IntActi
O54916, 4 interactors

Molecular INTeraction database

More...
MINTi
O54916

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000123238

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1795
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FI6NMR-A279-370[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O54916

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O54916

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O54916

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini10 – 113EH 1PROSITE-ProRule annotationAdd BLAST104
Domaini285 – 374EH 2PROSITE-ProRule annotationAdd BLAST90
Domaini318 – 353EF-handPROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni651 – 795Interaction with RALBP1Add BLAST145

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili750 – 790Sequence analysisAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi540 – 603Pro-richAdd BLAST64

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IRAU Eukaryota
ENOG410ZSYS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158749

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231382

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG056372

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O54916

KEGG Orthology (KO)

More...
KOi
K20068

Identification of Orthologs from Complete Genome Data

More...
OMAi
SQFQAFA

Database of Orthologous Groups

More...
OrthoDBi
1319710at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O54916

TreeFam database of animal gene trees

More...
TreeFami
TF316546

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00052 EH, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR000261 EH_dom
IPR026814 Reps1

The PANTHER Classification System

More...
PANTHERi
PTHR11216:SF63 PTHR11216:SF63, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12763 EF-hand_4, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00027 EH, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 1 hit
PS50031 EH, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O54916-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGLTLSDAE QKYYSDLFSY CDIESTKKVV VNGRVLELFR AAQLPNDVVL
60 70 80 90 100
QIMELCGATR LGYFGRSQFY IALKLVAVAQ SGFPLRVESI NTVKDLPLPR
110 120 130 140 150
FVASKNEQES RLAASYSSDS ENQGSYSGVI PPPPGRGQVK KGPGSHDAVQ
160 170 180 190 200
PRPSAEQQEP VSPVVSPQQS PPTSPHTWRK HSRHPSGGNS ERPLTGPGPF
210 220 230 240 250
WSPFGDAQAG SSAGDAVWSG QSPPPPQDNW VSFADTPPTS ALLTMHPASV
260 270 280 290 300
QDQTTVRTVA SAATANEIRR QSSSYEDPWK ITDEQRQYYV NQFKTIQPDL
310 320 330 340 350
NGFIPGSAAK EFFTKSKLPI LELSHIWELS DFDKDGALTL DEFCAAFHLV
360 370 380 390 400
VARKNGYDLP EKLPESLMPK LIDLEDSADV GEQPGEVGYS GSPAEAPPSK
410 420 430 440 450
SPSMPSLNQT WPELNQSSEQ WETFSERSSS SQTLTQFDSN IAPADPDTAI
460 470 480 490 500
VHPVPIRMTP SKIHMQEMEL KRTSSDHTNP TSPLLVKPSD LSEENKINSS
510 520 530 540 550
VKFPSGNTVD GYSSSDSFPS DPEQIGSSVT RQRSHSGTSP DNTAPPPPPP
560 570 580 590 600
RPQPSHSRSS SLDMNRTFAV TTGQQQAGVV AHPPAVPPRP QPSQAPGPSV
610 620 630 640 650
HRPVDADGLI THTSTSPQQI PEQPNFADFS QFEVFAASNV SEEQDSEAEK
660 670 680 690 700
HPEVLPAEKA SDPSSSLRAA QADSKAEEKT ATNVPANVSK GTTPLAPPPK
710 720 730 740 750
PVRRRLKSED ELRPDVDEHT QKTGVLAAVL TSQPSIPRSV GKDKKAIQAS
760 770 780 790
IRRNKETNTV LARLNSELQQ QLKDVLEERI SLEVQLEQLR PFSHL
Length:795
Mass (Da):86,519
Last modified:November 3, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i98D788160F560509
GO
Isoform 2 (identifier: O54916-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: Missing.
     420-454: QWETFSERSSSSQTLTQFDSNIAPADPDTAIVHPV → VSKTSLSLLEISLFTGRSFKQDRFTAGYLQYAHTP
     455-795: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:210
Mass (Da):23,378
Checksum:i0F50314C618EC731
GO
Isoform 3 (identifier: O54916-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     420-446: Missing.

Show »
Length:716
Mass (Da):77,614
Checksum:i2D37A40F959AA466
GO
Isoform 4 (identifier: O54916-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Show »
Length:743
Mass (Da):80,626
Checksum:i205B87DD9D8AC3A6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q632E9Q632_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
768Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z2E3D3Z2E3_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
705Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6R6F1F6R6F1_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
755Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7AB82F7AB82_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6YT69F6YT69_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RIN6D6RIN6_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1SRE4A0A1L1SRE4_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1SQL9A0A1L1SQL9_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
34Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAE29439 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAE30291 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti161V → A in AAB94736 (PubMed:9395447).Curated1
Sequence conflicti605D → N in BAE29439 (PubMed:16141072).Curated1
Sequence conflicti701P → T in BAE29439 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0383371 – 244Missing in isoform 2. 1 PublicationAdd BLAST244
Alternative sequenceiVSP_0383361 – 52Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST52
Alternative sequenceiVSP_007956420 – 454QWETF…IVHPV → VSKTSLSLLEISLFTGRSFK QDRFTAGYLQYAHTP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_038338420 – 446Missing in isoform 3. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_007957455 – 795Missing in isoform 2. 1 PublicationAdd BLAST341

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF031939 mRNA Translation: AAB94736.1
AK150284 mRNA Translation: BAE29439.1 Different initiation.
AK151309 mRNA Translation: BAE30291.1 Different initiation.
AK041967 mRNA Translation: BAC31117.1
AC153433 Genomic DNA No translation available.
BC002256 mRNA No translation available.
BC087547 mRNA Translation: AAH87547.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS23710.2 [O54916-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T09173

NCBI Reference Sequences

More...
RefSeqi
NP_001104535.1, NM_001111065.1
NP_033074.2, NM_009048.2 [O54916-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.4479

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000126390; ENSMUSP00000123238; ENSMUSG00000019854 [O54916-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
19707

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:19707

UCSC genome browser

More...
UCSCi
uc007ema.2 mouse [O54916-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF031939 mRNA Translation: AAB94736.1
AK150284 mRNA Translation: BAE29439.1 Different initiation.
AK151309 mRNA Translation: BAE30291.1 Different initiation.
AK041967 mRNA Translation: BAC31117.1
AC153433 Genomic DNA No translation available.
BC002256 mRNA No translation available.
BC087547 mRNA Translation: AAH87547.1
CCDSiCCDS23710.2 [O54916-1]
PIRiT09173
RefSeqiNP_001104535.1, NM_001111065.1
NP_033074.2, NM_009048.2 [O54916-1]
UniGeneiMm.4479

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FI6NMR-A279-370[»]
ProteinModelPortaliO54916
SMRiO54916
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202861, 1 interactor
CORUMiO54916
IntActiO54916, 4 interactors
MINTiO54916
STRINGi10090.ENSMUSP00000123238

PTM databases

iPTMnetiO54916
PhosphoSitePlusiO54916

Proteomic databases

EPDiO54916
jPOSTiO54916
MaxQBiO54916
PaxDbiO54916
PeptideAtlasiO54916
PRIDEiO54916

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000126390; ENSMUSP00000123238; ENSMUSG00000019854 [O54916-1]
GeneIDi19707
KEGGimmu:19707
UCSCiuc007ema.2 mouse [O54916-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
85021
MGIiMGI:1196373 Reps1

Phylogenomic databases

eggNOGiENOG410IRAU Eukaryota
ENOG410ZSYS LUCA
GeneTreeiENSGT00940000158749
HOGENOMiHOG000231382
HOVERGENiHBG056372
InParanoidiO54916
KOiK20068
OMAiSQFQAFA
OrthoDBi1319710at2759
PhylomeDBiO54916
TreeFamiTF316546

Enzyme and pathway databases

ReactomeiR-MMU-8856825 Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828 Clathrin-mediated endocytosis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Reps1 mouse
EvolutionaryTraceiO54916

Protein Ontology

More...
PROi
PR:O54916

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000019854 Expressed in 286 organ(s), highest expression level in submandibular gland
CleanExiMM_REPS1
ExpressionAtlasiO54916 baseline and differential
GenevisibleiO54916 MM

Family and domain databases

CDDicd00052 EH, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR000261 EH_dom
IPR026814 Reps1
PANTHERiPTHR11216:SF63 PTHR11216:SF63, 1 hit
PfamiView protein in Pfam
PF12763 EF-hand_4, 1 hit
SMARTiView protein in SMART
SM00027 EH, 2 hits
SUPFAMiSSF47473 SSF47473, 2 hits
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 1 hit
PS50031 EH, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiREPS1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O54916
Secondary accession number(s): Q3UAM3
, Q5PPQ9, Q8C9J9, Q99LR8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: November 3, 2009
Last modified: January 16, 2019
This is version 157 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again