Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RalBP1-associated Eps domain-containing protein 1

Gene

Reps1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May coordinate the cellular actions of activated EGF receptors and Ral-GTPases.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi331 – 342PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-MMU-8856825 Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828 Clathrin-mediated endocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
RalBP1-associated Eps domain-containing protein 1
Alternative name(s):
RalBP1-interacting protein 1
Gene namesi
Name:Reps1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1196373 Reps1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Coated pit, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000738301 – 795RalBP1-associated Eps domain-containing protein 1Add BLAST795

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei145PhosphoserineBy similarity1
Modified residuei162PhosphoserineBy similarity1
Modified residuei166PhosphoserineBy similarity1
Modified residuei170PhosphoserineBy similarity1
Modified residuei173PhosphothreonineBy similarity1
Modified residuei272PhosphoserineCombined sources1
Modified residuei273PhosphoserineCombined sources1
Modified residuei288PhosphotyrosineSequence analysis1
Modified residuei307PhosphoserineBy similarity1
Modified residuei475PhosphoserineBy similarity1
Modified residuei482PhosphoserineBy similarity1
Modified residuei489PhosphoserineBy similarity1
Modified residuei539PhosphoserineCombined sources1
Modified residuei543PhosphothreonineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei708PhosphoserineCombined sources1
Modified residuei739PhosphoserineBy similarity1

Post-translational modificationi

EGF stimulates phosphorylation on Tyr-residues.

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO54916
MaxQBiO54916
PaxDbiO54916
PeptideAtlasiO54916
PRIDEiO54916

PTM databases

iPTMnetiO54916
PhosphoSitePlusiO54916

Expressioni

Tissue specificityi

Expressed in all tissues examined. The highest level expression was found in the kidney and testis.

Gene expression databases

BgeeiENSMUSG00000019854 Expressed in 286 organ(s), highest expression level in submandibular gland
CleanExiMM_REPS1
ExpressionAtlasiO54916 baseline and differential
GenevisibleiO54916 MM

Interactioni

Subunit structurei

Homodimer (Potential). Interacts with RALBP1, CRK and GRB2. Binding to RALBP1 does not affect its Ral-binding activity. Forms a complex with the SH3 domains of CRK and GRB2 which may link it to an EGF-responsive tyrosine kinase. Interacts with RAB11FIP2 (By similarity). Interacts with AMPH, ITSN1 (via SH3 domains) and SGIP1; may be involved in clathrin-mediated endocytosis (By similarity).By similarityCurated

GO - Molecular functioni

Protein-protein interaction databases

BioGridi202861, 1 interactor
CORUMiO54916
IntActiO54916, 4 interactors
MINTiO54916
STRINGi10090.ENSMUSP00000123238

Structurei

Secondary structure

1795
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO54916
SMRiO54916
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO54916

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini10 – 113EH 1PROSITE-ProRule annotationAdd BLAST104
Domaini285 – 374EH 2PROSITE-ProRule annotationAdd BLAST90
Domaini318 – 353EF-handPROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni651 – 795Interaction with RALBP1Add BLAST145

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili750 – 790Sequence analysisAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi540 – 603Pro-richAdd BLAST64

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IRAU Eukaryota
ENOG410ZSYS LUCA
GeneTreeiENSGT00760000118985
HOGENOMiHOG000231382
HOVERGENiHBG056372
InParanoidiO54916
KOiK20068
OMAiSQFQAFA
OrthoDBiEOG091G028Q
PhylomeDBiO54916
TreeFamiTF316546

Family and domain databases

CDDicd00052 EH, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR000261 EH_dom
IPR026814 Reps1
PANTHERiPTHR11216:SF63 PTHR11216:SF63, 1 hit
PfamiView protein in Pfam
PF12763 EF-hand_4, 1 hit
SMARTiView protein in SMART
SM00027 EH, 2 hits
SUPFAMiSSF47473 SSF47473, 2 hits
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 1 hit
PS50031 EH, 2 hits

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O54916-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGLTLSDAE QKYYSDLFSY CDIESTKKVV VNGRVLELFR AAQLPNDVVL
60 70 80 90 100
QIMELCGATR LGYFGRSQFY IALKLVAVAQ SGFPLRVESI NTVKDLPLPR
110 120 130 140 150
FVASKNEQES RLAASYSSDS ENQGSYSGVI PPPPGRGQVK KGPGSHDAVQ
160 170 180 190 200
PRPSAEQQEP VSPVVSPQQS PPTSPHTWRK HSRHPSGGNS ERPLTGPGPF
210 220 230 240 250
WSPFGDAQAG SSAGDAVWSG QSPPPPQDNW VSFADTPPTS ALLTMHPASV
260 270 280 290 300
QDQTTVRTVA SAATANEIRR QSSSYEDPWK ITDEQRQYYV NQFKTIQPDL
310 320 330 340 350
NGFIPGSAAK EFFTKSKLPI LELSHIWELS DFDKDGALTL DEFCAAFHLV
360 370 380 390 400
VARKNGYDLP EKLPESLMPK LIDLEDSADV GEQPGEVGYS GSPAEAPPSK
410 420 430 440 450
SPSMPSLNQT WPELNQSSEQ WETFSERSSS SQTLTQFDSN IAPADPDTAI
460 470 480 490 500
VHPVPIRMTP SKIHMQEMEL KRTSSDHTNP TSPLLVKPSD LSEENKINSS
510 520 530 540 550
VKFPSGNTVD GYSSSDSFPS DPEQIGSSVT RQRSHSGTSP DNTAPPPPPP
560 570 580 590 600
RPQPSHSRSS SLDMNRTFAV TTGQQQAGVV AHPPAVPPRP QPSQAPGPSV
610 620 630 640 650
HRPVDADGLI THTSTSPQQI PEQPNFADFS QFEVFAASNV SEEQDSEAEK
660 670 680 690 700
HPEVLPAEKA SDPSSSLRAA QADSKAEEKT ATNVPANVSK GTTPLAPPPK
710 720 730 740 750
PVRRRLKSED ELRPDVDEHT QKTGVLAAVL TSQPSIPRSV GKDKKAIQAS
760 770 780 790
IRRNKETNTV LARLNSELQQ QLKDVLEERI SLEVQLEQLR PFSHL
Length:795
Mass (Da):86,519
Last modified:November 3, 2009 - v2
Checksum:i98D788160F560509
GO
Isoform 2 (identifier: O54916-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-244: Missing.
     420-454: QWETFSERSSSSQTLTQFDSNIAPADPDTAIVHPV → VSKTSLSLLEISLFTGRSFKQDRFTAGYLQYAHTP
     455-795: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:210
Mass (Da):23,378
Checksum:i0F50314C618EC731
GO
Isoform 3 (identifier: O54916-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     420-446: Missing.

Show »
Length:716
Mass (Da):77,614
Checksum:i2D37A40F959AA466
GO
Isoform 4 (identifier: O54916-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Show »
Length:743
Mass (Da):80,626
Checksum:i205B87DD9D8AC3A6
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q632E9Q632_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
768Annotation score:
D3Z2E3D3Z2E3_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
705Annotation score:
F6R6F1F6R6F1_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
755Annotation score:
F7AB82F7AB82_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
240Annotation score:
F6YT69F6YT69_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
210Annotation score:
D6RIN6D6RIN6_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
220Annotation score:
A0A1L1SRE4A0A1L1SRE4_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
94Annotation score:
A0A1L1SQL9A0A1L1SQL9_MOUSE
RalBP1-associated Eps domain-contai...
Reps1
34Annotation score:

Sequence cautioni

The sequence BAE29439 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAE30291 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti161V → A in AAB94736 (PubMed:9395447).Curated1
Sequence conflicti605D → N in BAE29439 (PubMed:16141072).Curated1
Sequence conflicti701P → T in BAE29439 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0383371 – 244Missing in isoform 2. 1 PublicationAdd BLAST244
Alternative sequenceiVSP_0383361 – 52Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST52
Alternative sequenceiVSP_007956420 – 454QWETF…IVHPV → VSKTSLSLLEISLFTGRSFK QDRFTAGYLQYAHTP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_038338420 – 446Missing in isoform 3. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_007957455 – 795Missing in isoform 2. 1 PublicationAdd BLAST341

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF031939 mRNA Translation: AAB94736.1
AK150284 mRNA Translation: BAE29439.1 Different initiation.
AK151309 mRNA Translation: BAE30291.1 Different initiation.
AK041967 mRNA Translation: BAC31117.1
AC153433 Genomic DNA No translation available.
BC002256 mRNA No translation available.
BC087547 mRNA Translation: AAH87547.1
CCDSiCCDS23710.2 [O54916-1]
PIRiT09173
RefSeqiNP_001104535.1, NM_001111065.1
NP_033074.2, NM_009048.2 [O54916-1]
UniGeneiMm.4479

Genome annotation databases

EnsembliENSMUST00000126390; ENSMUSP00000123238; ENSMUSG00000019854 [O54916-1]
GeneIDi19707
KEGGimmu:19707
UCSCiuc007ema.2 mouse [O54916-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF031939 mRNA Translation: AAB94736.1
AK150284 mRNA Translation: BAE29439.1 Different initiation.
AK151309 mRNA Translation: BAE30291.1 Different initiation.
AK041967 mRNA Translation: BAC31117.1
AC153433 Genomic DNA No translation available.
BC002256 mRNA No translation available.
BC087547 mRNA Translation: AAH87547.1
CCDSiCCDS23710.2 [O54916-1]
PIRiT09173
RefSeqiNP_001104535.1, NM_001111065.1
NP_033074.2, NM_009048.2 [O54916-1]
UniGeneiMm.4479

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FI6NMR-A279-370[»]
ProteinModelPortaliO54916
SMRiO54916
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202861, 1 interactor
CORUMiO54916
IntActiO54916, 4 interactors
MINTiO54916
STRINGi10090.ENSMUSP00000123238

PTM databases

iPTMnetiO54916
PhosphoSitePlusiO54916

Proteomic databases

EPDiO54916
MaxQBiO54916
PaxDbiO54916
PeptideAtlasiO54916
PRIDEiO54916

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000126390; ENSMUSP00000123238; ENSMUSG00000019854 [O54916-1]
GeneIDi19707
KEGGimmu:19707
UCSCiuc007ema.2 mouse [O54916-1]

Organism-specific databases

CTDi85021
MGIiMGI:1196373 Reps1

Phylogenomic databases

eggNOGiENOG410IRAU Eukaryota
ENOG410ZSYS LUCA
GeneTreeiENSGT00760000118985
HOGENOMiHOG000231382
HOVERGENiHBG056372
InParanoidiO54916
KOiK20068
OMAiSQFQAFA
OrthoDBiEOG091G028Q
PhylomeDBiO54916
TreeFamiTF316546

Enzyme and pathway databases

ReactomeiR-MMU-8856825 Cargo recognition for clathrin-mediated endocytosis
R-MMU-8856828 Clathrin-mediated endocytosis

Miscellaneous databases

ChiTaRSiReps1 mouse
EvolutionaryTraceiO54916
PROiPR:O54916
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000019854 Expressed in 286 organ(s), highest expression level in submandibular gland
CleanExiMM_REPS1
ExpressionAtlasiO54916 baseline and differential
GenevisibleiO54916 MM

Family and domain databases

CDDicd00052 EH, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR000261 EH_dom
IPR026814 Reps1
PANTHERiPTHR11216:SF63 PTHR11216:SF63, 1 hit
PfamiView protein in Pfam
PF12763 EF-hand_4, 1 hit
SMARTiView protein in SMART
SM00027 EH, 2 hits
SUPFAMiSSF47473 SSF47473, 2 hits
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 1 hit
PS50031 EH, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiREPS1_MOUSE
AccessioniPrimary (citable) accession number: O54916
Secondary accession number(s): Q3UAM3
, Q5PPQ9, Q8C9J9, Q99LR8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: November 3, 2009
Last modified: November 7, 2018
This is version 155 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again