Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (13 Feb 2019)
Sequence version 1 (01 Jun 1998)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Tissue factor pathway inhibitor

Gene

Tfpi

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei60 – 61Reactive bondBy similarity2
Sitei131 – 132Reactive bondBy similarity2
Sitei235 – 236Reactive bondBy similarity2

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • serine-type endopeptidase inhibitor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionProtease inhibitor, Serine protease inhibitor
Biological processBlood coagulation, Hemostasis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-140834 Extrinsic Pathway of Fibrin Clot Formation

Protein family/group databases

MEROPS protease database

More...
MEROPSi
I02.011

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tissue factor pathway inhibitor
Short name:
TFPI
Alternative name(s):
Extrinsic pathway inhibitor
Short name:
EPI
Lipoprotein-associated coagulation inhibitor
Short name:
LACI
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tfpi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1095418 Tfpi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 28By similarityAdd BLAST28
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001687329 – 306Tissue factor pathway inhibitorAdd BLAST278

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi50 ↔ 100PROSITE-ProRule annotation
Disulfide bondi59 ↔ 83PROSITE-ProRule annotation
Disulfide bondi75 ↔ 96PROSITE-ProRule annotation
Disulfide bondi121 ↔ 171PROSITE-ProRule annotation
Disulfide bondi130 ↔ 154PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi141N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi146 ↔ 167PROSITE-ProRule annotation
Disulfide bondi225 ↔ 275PROSITE-ProRule annotation
Disulfide bondi234 ↔ 258PROSITE-ProRule annotation
Disulfide bondi250 ↔ 271PROSITE-ProRule annotation
Glycosylationi254N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi264N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi282N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O54819

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O54819

PeptideAtlas

More...
PeptideAtlasi
O54819

PRoteomics IDEntifications database

More...
PRIDEi
O54819

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O54819

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O54819

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform alpha is expressed in heart and spleen; isoform beta in heart and lung.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000027082 Expressed in 252 organ(s), highest expression level in placenta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O54819 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O54819 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000028487

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O54819

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O54819

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini50 – 100BPTI/Kunitz inhibitor 1PROSITE-ProRule annotationAdd BLAST51
Domaini121 – 171BPTI/Kunitz inhibitor 2PROSITE-ProRule annotationAdd BLAST51
Domaini225 – 275BPTI/Kunitz inhibitor 3PROSITE-ProRule annotationAdd BLAST51

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa (By similarity).By similarity

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4295 Eukaryota
ENOG410XQNP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160767

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231818

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG056804

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O54819

KEGG Orthology (KO)

More...
KOi
K03909

Identification of Orthologs from Complete Genome Data

More...
OMAi
GFIQRIS

Database of Orthologous Groups

More...
OrthoDBi
1009074at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O54819

TreeFam database of animal gene trees

More...
TreeFami
TF315349

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00109 KU, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
4.10.410.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002223 Kunitz_BPTI
IPR036880 Kunitz_BPTI_sf
IPR020901 Prtase_inh_Kunz-CS
IPR008296 TFPI-like
IPR029864 TFPI1

The PANTHER Classification System

More...
PANTHERi
PTHR10083:SF317 PTHR10083:SF317, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00014 Kunitz_BPTI, 3 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001620 TFPI, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00759 BASICPTASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00131 KU, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57362 SSF57362, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00280 BPTI_KUNITZ_1, 3 hits
PS50279 BPTI_KUNITZ_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: O54819-1) [UniParc]FASTAAdd to basket
Also known as: TFPIalpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTYKMKKEYA FWATVCLLLS LVPEFLNALS EEADDTDSEL GSMKPLHTFC
60 70 80 90 100
AMKADDGPCK AMIRSYFFNM YTHQCEEFIY GGCEGNENRF DTLEECKKTC
110 120 130 140 150
IPGYEKTAVK AASGAERPDF CFLEEDPGLC RGYMKRYLYN NQTKQCERFV
160 170 180 190 200
YGGCLGNRNN FETLDECKKI CENPVHSPSP VNEVQMSDYV TDGNTVTDRS
210 220 230 240 250
TVNNIVVPQS PKVPRRRDYR GRPWCLQPAD SGLCKASERR FYYNSATGKC
260 270 280 290 300
HRFNYTGCGG NNNNFTTRRR CLRSCKTGLI KNKSKGVVKI QRRKAPFVKV

VYESIN
Length:306
Mass (Da):34,987
Last modified:June 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD3EA3297E4B6A359
GO
Isoform Beta (identifier: O54819-2) [UniParc]FASTAAdd to basket
Also known as: TFPIbeta

The sequence of this isoform differs from the canonical sequence as follows:
     218-253: DYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRF → VTKEETNGGWKNADYTYQGFLSSVYIHVLYFVFRIG
     254-306: Missing.

Show »
Length:253
Mass (Da):28,949
Checksum:iFDEAB02B634A810B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2ARA0A2ARA0_MOUSE
Tissue factor pathway inhibitor
Tfpi
300Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8BSB7Q8BSB7_MOUSE
Tissue factor pathway inhibitor
Tfpi
235Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2ARA3A2ARA3_MOUSE
Tissue factor pathway inhibitor
Tfpi
247Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2ARA4A2ARA4_MOUSE
Tissue factor pathway inhibitor
Tfpi
246Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti68F → L in AAD01586 (PubMed:9974373).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003032218 – 253DYRGR…KCHRF → VTKEETNGGWKNADYTYQGF LSSVYIHVLYFVFRIG in isoform Beta. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_003033254 – 306Missing in isoform Beta. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF004833 mRNA Translation: AAC40035.1
AF016313 mRNA Translation: AAD01586.1
AK028356 mRNA Translation: BAC25901.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16185.1 [O54819-1]

NCBI Reference Sequences

More...
RefSeqi
NP_035706.1, NM_011576.1 [O54819-1]
XP_006499208.1, XM_006499145.2 [O54819-1]
XP_006499209.1, XM_006499146.3 [O54819-1]
XP_006499210.1, XM_006499147.3
XP_006499211.1, XM_006499148.3
XP_006499212.1, XM_006499149.3 [O54819-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.124316
Mm.447013

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000028487; ENSMUSP00000028487; ENSMUSG00000027082 [O54819-1]
ENSMUST00000111718; ENSMUSP00000107347; ENSMUSG00000027082 [O54819-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
21788

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:21788

UCSC genome browser

More...
UCSCi
uc008kij.1 mouse [O54819-1]
uc008kim.1 mouse [O54819-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF004833 mRNA Translation: AAC40035.1
AF016313 mRNA Translation: AAD01586.1
AK028356 mRNA Translation: BAC25901.1
CCDSiCCDS16185.1 [O54819-1]
RefSeqiNP_035706.1, NM_011576.1 [O54819-1]
XP_006499208.1, XM_006499145.2 [O54819-1]
XP_006499209.1, XM_006499146.3 [O54819-1]
XP_006499210.1, XM_006499147.3
XP_006499211.1, XM_006499148.3
XP_006499212.1, XM_006499149.3 [O54819-2]
UniGeneiMm.124316
Mm.447013

3D structure databases

ProteinModelPortaliO54819
SMRiO54819
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000028487

Protein family/group databases

MEROPSiI02.011

PTM databases

iPTMnetiO54819
PhosphoSitePlusiO54819

Proteomic databases

MaxQBiO54819
PaxDbiO54819
PeptideAtlasiO54819
PRIDEiO54819

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028487; ENSMUSP00000028487; ENSMUSG00000027082 [O54819-1]
ENSMUST00000111718; ENSMUSP00000107347; ENSMUSG00000027082 [O54819-1]
GeneIDi21788
KEGGimmu:21788
UCSCiuc008kij.1 mouse [O54819-1]
uc008kim.1 mouse [O54819-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7035
MGIiMGI:1095418 Tfpi

Phylogenomic databases

eggNOGiKOG4295 Eukaryota
ENOG410XQNP LUCA
GeneTreeiENSGT00940000160767
HOGENOMiHOG000231818
HOVERGENiHBG056804
InParanoidiO54819
KOiK03909
OMAiGFIQRIS
OrthoDBi1009074at2759
PhylomeDBiO54819
TreeFamiTF315349

Enzyme and pathway databases

ReactomeiR-MMU-140834 Extrinsic Pathway of Fibrin Clot Formation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Tfpi mouse

Protein Ontology

More...
PROi
PR:O54819

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000027082 Expressed in 252 organ(s), highest expression level in placenta
ExpressionAtlasiO54819 baseline and differential
GenevisibleiO54819 MM

Family and domain databases

CDDicd00109 KU, 3 hits
Gene3Di4.10.410.10, 3 hits
InterProiView protein in InterPro
IPR002223 Kunitz_BPTI
IPR036880 Kunitz_BPTI_sf
IPR020901 Prtase_inh_Kunz-CS
IPR008296 TFPI-like
IPR029864 TFPI1
PANTHERiPTHR10083:SF317 PTHR10083:SF317, 1 hit
PfamiView protein in Pfam
PF00014 Kunitz_BPTI, 3 hits
PIRSFiPIRSF001620 TFPI, 1 hit
PRINTSiPR00759 BASICPTASE
SMARTiView protein in SMART
SM00131 KU, 3 hits
SUPFAMiSSF57362 SSF57362, 3 hits
PROSITEiView protein in PROSITE
PS00280 BPTI_KUNITZ_1, 3 hits
PS50279 BPTI_KUNITZ_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTFPI1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O54819
Secondary accession number(s): Q9Z2U8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: June 1, 1998
Last modified: February 13, 2019
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again